Novus Biologicals products are now on bio-techne.com

Recombinant Human SAM68 GST (N-Term) Protein

Name: Recombinant Human SAM68 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00010657-Q01
Price: 569 USD

Submit a Review

Images

(

Enlarge)

12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human SAM68 GST (N-Term) Protein Summary

Description	A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 176-275 of Human SAM68 Source: Wheat Germ (in vitro) Amino Acid Sequence: ILGPQGNTIKRLQEETGAKISVLGKGSMRDKAKEEELRKGGDPKYAHLNMDLHVFIEVFGPPCEAYALMAHAMEEVKKFLVPDMMDDICQEQFLELSYLN
Preparation Method	in vitro wheat germ expression system
Details of Functionality	This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source	Wheat germ
Protein/Peptide Type	Recombinant Protein
Gene	KHDRBS1
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	ELISA Immunoaffinity Purification Protein Array Western Blot
Theoretical MW	36.63 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -80C. Avoid freeze-thaw cycles.
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human SAM68 GST (N-Term) Protein

FLJ34027
GAP-associated tyrosine phosphoprotein p62
KH domain containing, RNA binding, signal transduction associated 1
KH domain-containing, RNA-binding, signal transduction-associated protein 1
KHDRBS1
p21 Ras GTPase-activating protein-associated p62
p62
p68
SAM68
Sam68GAP-associated tyrosine phosphoprotein p62 (Sam68)
Src-associated in mitosis 68 kDa protein

Background

KHDRBS1 - KH domain containing, RNA binding, signal transduction associated 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

p62/SQSTM1
Antibody (2C11)

H00008878-M01

(9 Reviews)

(412 Publications)

Species: Bv, Ha, Hu, Mu, Rb, Rt

Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

LC3A Antibody -
BSA Free

NB100-2331

(22 Reviews)

(306 Publications)

Species: Am, Ca, Fi, Hu, Mu, Pl, Rt, Ze

Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, IP, Simple Western, SB, WB

Src [p Tyr419]
Antibody [Unconjugate

AF2685

Simple Western Src [p Tyr419] Antibody [Unconjugated]

Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]

(1 Review)

(10 Publications)

Species: Hu

Applications: IHC, Simple Western, WB

DOK1 [p Tyr362]
Antibody

NB100-82112

Immunohistochemistry-Paraffin DOK1 [p Tyr362] Antibody

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

GTF2H1 Antibody
(1F12-1B5)

H00002965-M01

Immunocytochemistry/ Immunofluorescence GTF2H1 Antibody (1F12-1B5)

Immunohistochemistry-Paraffin GTF2H1 Antibody (1F12-1B5)

(2 Publications)

Species: Hu

Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB

Beclin 1 Antibody
- BSA Free

NB500-249

Simple Western Beclin 1 Antibody - BSA Free

Immunocytochemistry/ Immunofluorescence Beclin 1 Antibody - BSA Free

(9 Reviews)

(161 Publications)

Species: Hu, Mu, Rt

Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, Simple Western, WB

c-Myc Antibody
(9E10) - BSA Free

NB600-302

Western Blot c-Myc Antibody (9E10) - BSA Free

(4 Reviews)

(46 Publications)

Species: Bv, Dr, Hu, Mu

Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB

p53 Antibody (PAb
240) - BSA Free

NB200-103

Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free

(3 Reviews)

(42 Publications)

Species: Hu, Mu, Rt, Xp(-), Ye

Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

XPB Antibody

NB100-61060

(1 Review)

(3 Publications)

Species: Hu, Mu, Rb, V-Vi

Applications: ChIP, IP, WB

NFkB p105/p50
Antibody (2J10D7) - B ...

NB100-56583

(1 Review)

(5 Publications)

Species: Hu, Rb, Rt

Applications: Flow, IHC, IHC-P, KO, WB

GTF2H3 Antibody

NBP2-87539

Species: Hu

Applications: IHC, IHC-P, WB

ART4 Antibody

NBP1-80507

Species: Hu

Applications: WB

GTF2H2 Antibody
(PCRP-GTF2H2-1B9)

NBP3-07348

Flow Cytometry GTF2H2 Antibody (PCRP-GTF2H2-1B9)

Immunocytochemistry/ Immunofluorescence GTF2H2 Antibody (PCRP-GTF2H2-1B9)

Species: Hu

Applications: Flow, ICC/IF, PA

TOR/mTOR [p
Ser2448] Antibody

NB600-607

Western Blot TOR/mTOR [p Ser2448] Antibody

(2 Reviews)

(9 Publications)

Species: Hu, Rt

Applications: ELISA, IHC, IHC-P, WB

Nrf2 Antibody

NBP1-32822

(4 Reviews)

(71 Publications)

Species: Al, Av, Hu, Mu, Pl, Rt, Ze

Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB

c-Fos Antibody
(2H2)

NBP2-50037

Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)

(1 Review)

(19 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, KO, WB

ERK2 Antibody
[Unconjugated]

AF1230

Immunohistochemistry ERK2 Antibody [Unconjugated]

Knockout Validated ERK2 Antibody [Unconjugated]

(3 Publications)

Species: Hu, Mu, Rt

Applications: IHC, KO, WB

ARHGEF7 Antibody

NBP1-88650

Immunohistochemistry-Paraffin ARHGEF7 Antibody

Species: Hu

Applications: IHC, IHC-P, KD, WB

GTF2H4 Antibody

H00002968-B01P

Immunocytochemistry/ Immunofluorescence GTF2H4 Antibody

Species: Hu

Applications: ICC/IF, WB

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(807 Publications)

Species: Hu

Applications: BA

Publications for SAM68 Partial Recombinant Protein (H00010657-Q01) (0)

There are no publications for SAM68 Partial Recombinant Protein (H00010657-Q01).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SAM68 Partial Recombinant Protein (H00010657-Q01) (0)

There are no reviews for SAM68 Partial Recombinant Protein (H00010657-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SAM68 Partial Recombinant Protein (H00010657-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional SAM68 Products

Research Areas for SAM68 Partial Recombinant Protein (H00010657-Q01)

Find related products by research area.

Signal Transduction

Blogs on SAM68

There are no specific blogs for SAM68, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.

TNF-alpha [Unconjugated]
210-TA-005

SAM68 Antibody
NBP1-19151

p62/SQSTM1 Antibody (2C11)
H00008878-M01

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our Recombinant Human SAM68 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol

KHDRBS1

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Recombinant Human SAM68 GST (N-Term) Protein

Species Glossary

Images

Product Details

Order Details

Recombinant Human SAM68 GST (N-Term) Protein Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for Recombinant Human SAM68 GST (N-Term) Protein

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for SAM68 Partial Recombinant Protein (H00010657-Q01) (0)

Reviews for SAM68 Partial Recombinant Protein (H00010657-Q01) (0)

Product General Protocols

Video Protocols

FAQs for SAM68 Partial Recombinant Protein (H00010657-Q01) (0)

Additional SAM68 Products

Research Areas for SAM68 Partial Recombinant Protein (H00010657-Q01)

Blogs on SAM68

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics