![Immunohistochemistry-Paraffin: RWDD1 Antibody [NBP1-80871] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/RWDD1-Antibody-Immunohistochemistry-Paraffin-NBP1-80871-img0009.jpg "Immunohistochemistry-Paraffin: RWDD1 Antibody [NBP1-80871] - Staining of human stomach shows moderate cytoplasmic positivity in glandular cells.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FTLVTAVQEKLNEIVDQIKTRREEEKKQKEKEAEEAEKQLFHGTPVTIENFLNWKAKFDAELLEI |
| Predicted Species | Mouse (97%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RWDD1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publications using NBP1-80871 | Applications | Species |
|---|---|---|
| vorgelegt v, Wen W Expression and function of blood receptors ROR?, REVERBA and BMAL1 in human colorectal cancer Thesis 2022-01-01 (IF/IHC, Mouse) | IF/IHC | Mouse |
| Bo T, Chenchen Q, Huihui L et al Blockade of CCR5 and CXCR3 attenuates murine acute graft-versus-host disease through modulating donor-derived T cell distribution and function Research Square 2022-11-14 (IHC-P, Mouse) | IHC-P | Mouse |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: RWDD1 Antibody [NBP1-80871] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/RWDD1-Antibody-Immunohistochemistry-Paraffin-NBP1-80871-img0006.jpg "Immunohistochemistry-Paraffin: RWDD1 Antibody [NBP1-80871] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: RWDD1 Antibody [NBP1-80871] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/RWDD1-Antibody-Immunohistochemistry-Paraffin-NBP1-80871-img0007.jpg "Immunohistochemistry-Paraffin: RWDD1 Antibody [NBP1-80871] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: RWDD1 Antibody [NBP1-80871] - Staining of human pancreas shows moderate granular cytoplasmic positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/RWDD1-Antibody-Immunohistochemistry-Paraffin-NBP1-80871-img0008.jpg "Immunohistochemistry-Paraffin: RWDD1 Antibody [NBP1-80871] - Staining of human pancreas shows moderate granular cytoplasmic positivity in exocrine glandular cells.")
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Immunohistochemistry FABP7/B-FABP Antibody [Unconjugated]](https://images.novusbio.com/images2/FABP7_AF3166_Immunohistochemistry_6776.jpg)
![Simple Western FABP7/B-FABP Antibody [Unconjugated]](https://images.novusbio.com/images2/FABP7_AF3166_Simple_Western_18665.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")