![Western Blot: ROCK2 Antibody [NBP1-86124] - Analysis in human cell line RH-30.](http://images.novusbio.com/fullsize/ROCK2-Antibody-Western-Blot-NBP1-86124-img0010.jpg "Western Blot: ROCK2 Antibody [NBP1-86124] - Analysis in human cell line RH-30.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FVGNQLPFIGFTYYRENLLLSDSPSCRETDSIQSRKNEESQEIQKKLYTLEEHLSNEMQAKEELEQKCKSVNTRLEKTAKELEEEITLRKSVESALRQLEREKALLQHKNAEYQRKADHEADK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ROCK2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | WB reported in scientific literature (PMID: 26330114). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for ROCK2 Antibody (NBP1-86124)Find related products by research area.
|
|
TGF-beta for treating degenerative intervertebral disc disease By Jamshed Arslan Pharm.D. Our upright posture and balance depend on a jelly-like material, called nucleus pulposus (NP), in the middle of intervertebral discs. NP cells protect us from disc degeneration by maintain... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ROCK2 |
![Immunohistochemistry-Paraffin: ROCK2 Antibody [NBP1-86124] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/ROCK2-Antibody-Immunohistochemistry-Paraffin-NBP1-86124-img0014.jpg "Immunohistochemistry-Paraffin: ROCK2 Antibody [NBP1-86124] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Western Blot: ROCK2 Antibody [NBP1-86124] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/ROCK2-Antibody-Western-Blot-NBP1-86124-img0009.jpg "Western Blot: ROCK2 Antibody [NBP1-86124] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: ROCK2 Antibody [NBP1-86124] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/ROCK2-Antibody-Immunohistochemistry-Paraffin-NBP1-86124-img0001.jpg "Immunohistochemistry-Paraffin: ROCK2 Antibody [NBP1-86124] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: ROCK2 Antibody [NBP1-86124] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/ROCK2-Antibody-Immunohistochemistry-Paraffin-NBP1-86124-img0012.jpg "Immunohistochemistry-Paraffin: ROCK2 Antibody [NBP1-86124] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: ROCK2 Antibody [NBP1-86124] - Staining of human colorectal cancer shows strong cytoplasmic positivity in tumor cells.](http://images.novusbio.com/fullsize/ROCK2-Antibody-Immunohistochemistry-Paraffin-NBP1-86124-img0013.jpg "Immunohistochemistry-Paraffin: ROCK2 Antibody [NBP1-86124] - Staining of human colorectal cancer shows strong cytoplasmic positivity in tumor cells.")
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![N/A Endothelin-1 [HRP]](https://images.novusbio.com/images2/Endothelin-1_QET00_ELISA_432.jpg)
![N/A Endothelin-1 [HRP]](https://images.novusbio.com/images2/DATA_Endothelin1_QET00_ELISA_1074.jpg)
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22971.jpg)
![Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunohistochemistry_22972.jpg)
![Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]](https://images.novusbio.com/images2/Myosin_Heavy_Chain_MAB4470_Immunocytochemistry_9890.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")