Myosin Phosphatase Antibody Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human Myosin Phosphatase (NP_002471.1).
Sequence: MKMADAKQKRNEQLKRWIGSETDLEPPVVKRQKTKVKFDDGAVFLAACSSGDTDEVLKLLHRGADINYANVDGLTALHQACIDDNVDMVKFLVENGANINQPDNEGWIPLHAAASCGYLDIAEFLIGQGAHVGAVNSEGDTPLDIAEEEAMEELLQNEVNRQGVDIEAARKEEERIMLRDARQWLNSGHINDVRHAKSGG |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PPP1R12A |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells
- Western Blot 1:500 - 1:2000
|
Theoretical MW |
115 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.01% Thimerosal |
Purity |
Affinity purified |
Alternate Names for Myosin Phosphatase Antibody
Background
The major protein phosphatase-1 (PP1) is composed of 3 subunits with apparent molecular mass of 110-130, 37 & 20 kDa. The 110-130 kDa component act as a regulatory subunit known as myosine binding (MBS) or myosine phosphatae targeting subunit (MYPT). The N-terminal portion of MYPT binds to both PP1c-delta and phosphorylated myosin, thereby increasing myosin phosphatase activity. Two isoform of MYPT have been identified (MYPT1 & MYPT2) and share 61% sequence identity. While MYPT1 is widely distributed in human tissues, MYPT2 is mostly detected in brain and heart.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, KD, WB
Species: All-Multi
Applications: ICC, IHC, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Publications for Myosin Phosphatase Antibody (NBP3-35077) (0)
There are no publications for Myosin Phosphatase Antibody (NBP3-35077).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Myosin Phosphatase Antibody (NBP3-35077) (0)
There are no reviews for Myosin Phosphatase Antibody (NBP3-35077).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Myosin Phosphatase Antibody (NBP3-35077) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Myosin Phosphatase Products
Research Areas for Myosin Phosphatase Antibody (NBP3-35077)
Find related products by research area.
|
Blogs on Myosin Phosphatase