![Western Blot: Ribosomal Protein S6/RPS6 Antibody (4C7P4) [NBP3-15435] - Western blot analysis of extracts of various cell lines, using Ribosomal Protein S6/RPS6 antibody (NBP3-15435) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.](http://images.novusbio.com/fullsize/Ribosomal-Protein-S6-RPS6-Antibody-4C7P4-Western-Blot-NBP3-15435-img0001.jpg "Western Blot: Ribosomal Protein S6/RPS6 Antibody (4C7P4) [NBP3-15435] - Western blot analysis of extracts of various cell lines, using Ribosomal Protein S6/RPS6 antibody (NBP3-15435) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clone | 4C7P4 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human RPS6 (NP_001001.2). MKLNISFPATGCQKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVRISGGNDKQGFPMKQGVLTHGRVRLLLSKGHSCYRPRRTGERKRKSVRGCIVDANLSVLNLVIVKKGEKDIPGLTDTTVP |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | RPS6 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 29 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.09% Sodium Azide |
| Purity | Affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
![Simple Western EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Simple_Western_21454.jpg)
![Western Blot EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Western_Blot_21511.jpg)
![Immunocytochemistry EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Immunocytochemistry__Immunofluorescence_17288.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Ribosomal Protein S6/RPS6 Antibody (NBP3-15435)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RPS6 |
![ICC/IF: Ribosomal Protein S6/RPS6 Antibody (4C7P4) [NBP3-15435] -Confocal imaging of NIH/3T3 cells using S6 Ribosomal Protein (RPS6) Rabbit mAb (dilution 1:100)(Red). The cells were counterstained with alpha -Tubulin Mouse mAb (dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.](http://images.novusbio.com/fullsize/nbp3-15435_rabbit-ribosomal-protein-s6-rps6-mab-4c7p4-immunocytochemistry-immunofluorescence-16120251042..png "ICC/IF: Ribosomal Protein S6/RPS6 Antibody (4C7P4) [NBP3-15435] -Confocal imaging of NIH/3T3 cells using S6 Ribosomal Protein (RPS6) Rabbit mAb (dilution 1:100)(Red). The cells were counterstained with alpha -Tubulin Mouse mAb (dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.")
![ICC/IF: Ribosomal Protein S6/RPS6 Antibody (4C7P4) [NBP3-15435] -Confocal imaging of C6 cells using S6 Ribosomal Protein (RPS6) Rabbit mAb (dilution 1:100)(Red). The cells were counterstained with alpha -Tubulin Mouse mAb (dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.](http://images.novusbio.com/fullsize/nbp3-15435_rabbit-ribosomal-protein-s6-rps6-mab-4c7p4-immunocytochemistry-immunofluorescence-161202510555..png "ICC/IF: Ribosomal Protein S6/RPS6 Antibody (4C7P4) [NBP3-15435] -Confocal imaging of C6 cells using S6 Ribosomal Protein (RPS6) Rabbit mAb (dilution 1:100)(Red). The cells were counterstained with alpha -Tubulin Mouse mAb (dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.")
![Immunocytochemistry/ Immunofluorescence: Ribosomal Protein S6/RPS6 Antibody (4C7P4) [Ribosomal Protein S6/RPS6] - Confocal imaging of NIH/3T3 cells using Ribosomal Protein S6/RPS6 Rabbit mAb . The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.](http://images.novusbio.com/fullsize/nbp3-15435_rabbit-ribosomal-protein-s6-rps6-mab-4c7p4-52202517213526.jpg "Immunocytochemistry/ Immunofluorescence: Ribosomal Protein S6/RPS6 Antibody (4C7P4) [Ribosomal Protein S6/RPS6] - Confocal imaging of NIH/3T3 cells using Ribosomal Protein S6/RPS6 Rabbit mAb . The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.")
![Immunocytochemistry/ Immunofluorescence: Ribosomal Protein S6/RPS6 Antibody (4C7P4) [Ribosomal Protein S6/RPS6] - Confocal imaging of C6 cells using Ribosomal Protein S6/RPS6 Rabbit mAb . The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.](http://images.novusbio.com/fullsize/nbp3-15435_rabbit-ribosomal-protein-s6-rps6-mab-4c7p4-52202517152772.jpg "Immunocytochemistry/ Immunofluorescence: Ribosomal Protein S6/RPS6 Antibody (4C7P4) [Ribosomal Protein S6/RPS6] - Confocal imaging of C6 cells using Ribosomal Protein S6/RPS6 Rabbit mAb . The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.")
![Immunohistochemistry-Paraffin TOR/mTOR [p Ser2448] Antibody - BSA Free](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Immunohistochemistry-Paraffin-NB600-607-img0005.jpg)
![Western Blot TOR/mTOR [p Ser2448] Antibody - BSA Free](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-Western-Blot-NB600-607-img0006.jpg)
![Data TOR/mTOR [p Ser2448] Antibody - BSA Free](https://images.novusbio.com/images/TOR-mTOR-[p-Ser2448]-Antibody-N-A-NB600-607-img0008.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Immunocytochemistry RSK1 [p Ser380] Antibody (1024A) [Unconjugated]](https://images.novusbio.com/images2/RSK1_MAB79671_Immunocytochemistry_15894.jpg)
![Simple Western RSK1 [p Ser380] Antibody (1024A) [Unconjugated]](https://images.novusbio.com/images2/16242.jpg)
![Western Blot RSK1 [p Ser380] Antibody (1024A) [Unconjugated]](https://images.novusbio.com/images2/RSK1_MAB79671_Western_Blot_14193.jpg)
![Simple Western PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]](https://images.novusbio.com/images2/PYK2_MAB6210_Simple_Western_16639.jpg)
![Western Blot PYK2/FAK2 [p Tyr402] Antibody (592918) [Unconjugated]](https://images.novusbio.com/images2/PYK2_MAB6210_Western_Blot_9430.jpg)
![Western Blot eIF4E [p Ser209] Antibody - BSA Free](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Western-Blot-NB100-81898-img0009.jpg)
![Immunocytochemistry/ Immunofluorescence eIF4E [p Ser209] Antibody - BSA Free](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Immunocytochemistry-Immunofluorescence-NB100-81898-img0005.jpg)
![Immunohistochemistry-Paraffin eIF4E [p Ser209] Antibody - BSA Free](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Immunohistochemistry-NB100-81898-img0006.jpg)
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")