![Western Blot: RENT1/UPF1/hUPF1 Antibody (5D5C4) [NBP3-16544] - Western blot analysis of extracts of various cell lines, using RENT1/UPF1/hUPF1 Rabbit mAb (NBP3-16544) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.](http://images.novusbio.com/fullsize/RENT1-UPF1-hUPF1-Antibody-5D5C4-Western-Blot-NBP3-16544-img0002.jpg "Western Blot: RENT1/UPF1/hUPF1 Antibody (5D5C4) [NBP3-16544] - Western blot analysis of extracts of various cell lines, using RENT1/UPF1/hUPF1 Rabbit mAb (NBP3-16544) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IP |
| Clone | 5D5C4 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human RENT1/UPF1/hUPF1 (Q92900). MSVEAYGPSSQTLTFLDTEEAELLGADTQGSEFEFTDFTLPSQTQTPPGGPGGPGGGGAGGPGGAGAGAAAGQLDAQVGPEGILQNGAVDDSVAKTSQLL |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | UPF1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for RENT1/UPF1/hUPF1 Antibody (NBP3-16544)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | UPF1 |
![Immunocytochemistry/Immunofluorescence: RENT1/UPF1/hUPF1 Antibody (5D5C4) [NBP3-16544] - Immunofluorescence analysis of C6 cells using RENT1/UPF1/hUPF1 Rabbit mAb (NBP3-16544) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/RENT1-UPF1-hUPF1-Antibody-5D5C4-Immunocytochemistry-Immunofluorescence-NBP3-16544-img0001.jpg "Immunocytochemistry/Immunofluorescence: RENT1/UPF1/hUPF1 Antibody (5D5C4) [NBP3-16544] - Immunofluorescence analysis of C6 cells using RENT1/UPF1/hUPF1 Rabbit mAb (NBP3-16544) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunoprecipitation: RENT1/UPF1/hUPF1 Antibody (5D5C4) [NBP3-16544] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug RENT1/UPF1/hUPF1 antibody (NBP3-16544). Western blot was performed from the immunoprecipitate using RENT1/UPF1/hUPF1 antibody (NBP3-16544) at a dilition of 1:1000.](http://images.novusbio.com/fullsize/RENT1-UPF1-hUPF1-Antibody-5D5C4-Immunoprecipitation-NBP3-16544-img0003.jpg "Immunoprecipitation: RENT1/UPF1/hUPF1 Antibody (5D5C4) [NBP3-16544] - Immunoprecipitation analysis of 300ug extracts of HeLa cells using 3ug RENT1/UPF1/hUPF1 antibody (NBP3-16544). Western blot was performed from the immunoprecipitate using RENT1/UPF1/hUPF1 antibody (NBP3-16544) at a dilition of 1:1000.")
![Immunocytochemistry/ Immunofluorescence: RENT1/UPF1/hUPF1 Antibody (5D5C4) [NBP3-16544] - Confocal imaging of C6 cells using RENT1/UPF1/hUPF1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.](http://images.novusbio.com/fullsize/nbp3-16544_rabbit-rent1-upf1-hupf1-mab-5d5c4-52202511411479.jpg "Immunocytochemistry/ Immunofluorescence: RENT1/UPF1/hUPF1 Antibody (5D5C4) [NBP3-16544] - Confocal imaging of C6 cells using RENT1/UPF1/hUPF1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L).The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo(R) 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.")
![Immunocytochemistry/ Immunofluorescence: RENT1/UPF1/hUPF1 Antibody (5D5C4) [RENT1/UPF1/hUPF1] - Confocal imaging of C6 cells using RENT1/UPF1/hUPF1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) .The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.](http://images.novusbio.com/fullsize/nbp3-16544_rabbit-rent1-upf1-hupf1-mab-5d5c4-52202517152731.jpg "Immunocytochemistry/ Immunofluorescence: RENT1/UPF1/hUPF1 Antibody (5D5C4) [RENT1/UPF1/hUPF1] - Confocal imaging of C6 cells using RENT1/UPF1/hUPF1 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) .The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.")
![Immunohistochemistry Ret Antibody [Unconjugated]](https://images.novusbio.com/images2/Ret_AF482_Immunohistochemistry_10194.jpg)
![Western Blot Ret Antibody [Unconjugated]](https://images.novusbio.com/images/af482_mouse-ret-affinity-purified-polyclonal-ab-8220249503265.jpg)
![Immunohistochemistry Ret Antibody [Unconjugated]](https://images.novusbio.com/images/af482_mouse-ret-affinity-purified-polyclonal-ab-8220249505961.jpg)
![Immunohistochemistry Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)](https://images.novusbio.com/images2/Patched_1_MAB41051_Immunohistochemistry_15456.jpg)
![Western Blot Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)](https://images.novusbio.com/images2/Patched_1_MAB41051_Western_Blot_10905.jpg)
![Immunohistochemistry Patched 1/PTCH Antibody (413220) [Unconjugated] - (First Extracellular Loop)](https://images.novusbio.com/images2/Patched_1_MAB41051_Immunohistochemistry_7016.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")