![Western Blot: RCN1 Antibody [NBP1-83483] - Analysis using Anti-RCN1 antibody NBP1-83483 (A) shows similar pattern to independent antibody NBP2-37987 (B).](http://images.novusbio.com/fullsize/RCN1-Antibody-Western-Blot-NBP1-83483-img0014.jpg "Western Blot: RCN1 Antibody [NBP1-83483] - Analysis using Anti-RCN1 antibody NBP1-83483 (A) shows similar pattern to independent antibody NBP2-37987 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQA |
| Predicted Species | Rat (92%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RCN1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Flow Cytometry ERMAP Antibody [Unconjugated]](https://images.novusbio.com/images2/ERMAP_AF4928_Flow_Cytometry_11957.jpg)
![Immunohistochemistry Neurophysin II/Arg-vasopressin Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af009_human-neurophysin-ii-affinity-purified-polyclonal-ab-immunohistochemistry-2812202013195.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for RCN1 Antibody (NBP1-83483)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RCN1 |
![Immunocytochemistry/Immunofluorescence: RCN1 Antibody [NBP1-83483] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/RCN1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83483-img0008.jpg "Immunocytochemistry/Immunofluorescence: RCN1 Antibody [NBP1-83483] - Staining of human cell line U-2 OS shows localization to endoplasmic reticulum. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: RCN1 Antibody [NBP1-83483] - Staining of human pancreas shows very weak cytoplasmic positivity in intercalated ducts and Islets of Langerhans.](http://images.novusbio.com/fullsize/RCN1-Antibody-Immunohistochemistry-Paraffin-NBP1-83483-img0013.jpg "Immunohistochemistry-Paraffin: RCN1 Antibody [NBP1-83483] - Staining of human pancreas shows very weak cytoplasmic positivity in intercalated ducts and Islets of Langerhans.")
![Western Blot: RCN1 Antibody [NBP1-83483] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/RCN1-Antibody-Western-Blot-NBP1-83483-img0007.jpg "Western Blot: RCN1 Antibody [NBP1-83483] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Immunohistochemistry-Paraffin: RCN1 Antibody [NBP1-83483] - Staining of human small intestine shows moderate cytoplasmic positivity in Paneth cells](http://images.novusbio.com/fullsize/RCN1-Antibody-Immunohistochemistry-Paraffin-NBP1-83483-img0010.jpg "Immunohistochemistry-Paraffin: RCN1 Antibody [NBP1-83483] - Staining of human small intestine shows moderate cytoplasmic positivity in Paneth cells")
![Immunohistochemistry-Paraffin: RCN1 Antibody [NBP1-83483] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/RCN1-Antibody-Immunohistochemistry-Paraffin-NBP1-83483-img0011.jpg "Immunohistochemistry-Paraffin: RCN1 Antibody [NBP1-83483] - Staining of human endometrium shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: RCN1 Antibody [NBP1-83483] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/RCN1-Antibody-Immunohistochemistry-Paraffin-NBP1-83483-img0012.jpg "Immunohistochemistry-Paraffin: RCN1 Antibody [NBP1-83483] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.")
![Simple Western Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Simple_Western_17126.jpg)
![Immunocytochemistry Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Immunocytochemistry_14427.jpg)
![Western Blot Pax6 Antibody [Unconjugated]](https://images.novusbio.com/images2/Pax6_AF8150_Western_Blot_14743.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")