![Immunohistochemistry-Paraffin: RAB27B Antibody [NBP1-89538] - Staining in human prostate and tonsil tissues . Corresponding RAB27B RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/RAB27B-Antibody-Immunohistochemistry-Paraffin-NBP1-89538-img0012.jpg "Immunohistochemistry-Paraffin: RAB27B Antibody [NBP1-89538] - Staining in human prostate and tonsil tissues . Corresponding RAB27B RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC |
| Predicted Species | Mouse (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RAB27B |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for RAB27B Antibody (NBP1-89538)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | RAB27B |
![Western Blot: RAB27B Antibody [NBP1-89538] - Analysis in control (vector only transfected HEK293T lysate) and RAB27B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/RAB27B-Antibody-Western-Blot-NBP1-89538-img0013.jpg "Western Blot: RAB27B Antibody [NBP1-89538] - Analysis in control (vector only transfected HEK293T lysate) and RAB27B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
![Immunohistochemistry-Paraffin: RAB27B Antibody [NBP1-89538] - Staining of human prostate shows strong apical membrane and cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/RAB27B-Antibody-Immunohistochemistry-Paraffin-NBP1-89538-img0014.jpg "Immunohistochemistry-Paraffin: RAB27B Antibody [NBP1-89538] - Staining of human prostate shows strong apical membrane and cytoplasmic positivity in glandular cells.")
![Western Blot: RAB27B Antibody [NBP1-89538] - Analysis in human cell line U-87 MG.](http://images.novusbio.com/fullsize/RAB27B-Antibody-Western-Blot-NBP1-89538-img0007.jpg "Western Blot: RAB27B Antibody [NBP1-89538] - Analysis in human cell line U-87 MG.")
![Immunohistochemistry-Paraffin: RAB27B Antibody [NBP1-89538] - Staining of human cerebral cortex shows moderate positivity in neuropil.](http://images.novusbio.com/fullsize/RAB27B-Antibody-Immunohistochemistry-Paraffin-NBP1-89538-img0008.jpg "Immunohistochemistry-Paraffin: RAB27B Antibody [NBP1-89538] - Staining of human cerebral cortex shows moderate positivity in neuropil.")
![Immunohistochemistry-Paraffin: RAB27B Antibody [NBP1-89538] - Staining of human small intestine shows strong positivity in apical membranes in glandular cells.](http://images.novusbio.com/fullsize/RAB27B-Antibody-Immunohistochemistry-Paraffin-NBP1-89538-img0010.jpg "Immunohistochemistry-Paraffin: RAB27B Antibody [NBP1-89538] - Staining of human small intestine shows strong positivity in apical membranes in glandular cells.")
![Immunohistochemistry-Paraffin: RAB27B Antibody [NBP1-89538] - Staining of human tonsil shows mainly very weak positivity in lymphoid cells as expected.](http://images.novusbio.com/fullsize/RAB27B-Antibody-Immunohistochemistry-Paraffin-NBP1-89538-img0011.jpg "Immunohistochemistry-Paraffin: RAB27B Antibody [NBP1-89538] - Staining of human tonsil shows mainly very weak positivity in lymphoid cells as expected.")
![Western Blot Rap1A/B Antibody [Unconjugated]](https://images.novusbio.com/images2/Rap1B_AF3767_Western_Blot_5331.jpg)
![Western Blot Rap1A/B Antibody [Unconjugated]](https://images.novusbio.com/images2/Rap1B_AF3767_Western_Blot_6316.jpg)
![Immunohistochemistry Rap1A/B Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3767_human-mouse-rat-rap1a-b-affinity-purified-polyclonal-ab-immunohistochemistry-318202392533..jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")