![Western Blot: RAB27B Antibody [NBP1-79631] - Tumor cell-released Hsp70/90-expressing EVs induce muscle catabolism in myotubes. Hsp70/90 release by cachexia-inducing tumor cells is dependent on EV release. Rab27a and Rab27b were knocked down by transfecting LLC and C26 cells with control or specific siRNAs. EVs and Hsp70/90 released into conditioned media were quantified after Brij98 treatment. EVs were quantified by AchE. Data (n?=?3) were analyzed by Student t-test. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-017-00726-x) licensed under a CC-BY license.](http://images.novusbio.com/fullsize/RAB27B-Antibody-Western-Blot-NBP1-79631-img0003.jpg "Western Blot: RAB27B Antibody [NBP1-79631] - Tumor cell-released Hsp70/90-expressing EVs induce muscle catabolism in myotubes. Hsp70/90 release by cachexia-inducing tumor cells is dependent on EV release. Rab27a and Rab27b were knocked down by transfecting LLC and C26 cells with control or specific siRNAs. EVs and Hsp70/90 released into conditioned media were quantified after Brij98 treatment. EVs were quantified by AchE. Data (n?=?3) were analyzed by Student t-test. Image collected and cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-017-00726-x) licensed under a CC-BY license.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | The immunogen for this antibody is Rab27b. Peptide sequence YCENPDIVLIGNKADLPDQREVNERQARELAEKYGIPYFETSAATGQNVE. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | RAB27B |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Theoretical MW | 24 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for RAB27B Antibody (NBP1-79631)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: RAB27B Antibody [NBP1-79631] - Rab27b Antibody Titration: 0.5 ug/ml Positive Control: human testis, mouse liver, brain and testis](http://images.novusbio.com/fullsize/RAB27B-Antibody-Western-Blot-NBP1-79631-img0001.jpg "Western Blot: RAB27B Antibody [NBP1-79631] - Rab27b Antibody Titration: 0.5 ug/ml Positive Control: human testis, mouse liver, brain and testis")
![Western Blot: RAB27B Antibody [NBP1-79631] - Mouse Heart Lysate 1ug/ml Gel Concentration 12%](http://images.novusbio.com/fullsize/RAB27B-Antibody-Western-Blot-NBP1-79631-img0002.jpg "Western Blot: RAB27B Antibody [NBP1-79631] - Mouse Heart Lysate 1ug/ml Gel Concentration 12%")
![Western Blot: RAB27B Antibody [NBP1-79631] - Tumor cell-released Hsp70/90-expressing EVs are critical to the development of muscle wasting in mice. a Elevation of serum Hsp70/90 in LLC tumor-bearing mice is dependent on EV release. LLC cells transduced with lentivirus encoding Rab27a- & Rab27b-specific shRNA or empty vector were analyzed for knockdown effect by western blotting (top). Mice were then implanted with Rab27-deficient or control LLC cells. In 21 days serum levels of EVs, Hsp70/90 were analyzed. b Rab27-deficient LLC tumor does not induce muscle catabolism in mice. Mice derived from a were analyzed for activity of the catabolic markers in TA. c Rab27-deficient LLC tumor does not induce muscle wasting in mice. Mice derived from a were analyzed for muscle wasting. Scale bar, 100 μm. Data (n = 6) were analyzed by analysis of variance or χ2 analysis (for CSA). * denotes a difference (P < 0.05) Image collected & cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-017-00726-x), licensed under a CC-BY license. Not internally tested by Novus Biologicals.](http://images.novusbio.com/fullsize/nbp1-79631_rabbit-polyclonal-rab27b-antibody-310202416163793.jpg "Western Blot: RAB27B Antibody [NBP1-79631] - Tumor cell-released Hsp70/90-expressing EVs are critical to the development of muscle wasting in mice. a Elevation of serum Hsp70/90 in LLC tumor-bearing mice is dependent on EV release. LLC cells transduced with lentivirus encoding Rab27a- & Rab27b-specific shRNA or empty vector were analyzed for knockdown effect by western blotting (top). Mice were then implanted with Rab27-deficient or control LLC cells. In 21 days serum levels of EVs, Hsp70/90 were analyzed. b Rab27-deficient LLC tumor does not induce muscle catabolism in mice. Mice derived from a were analyzed for activity of the catabolic markers in TA. c Rab27-deficient LLC tumor does not induce muscle wasting in mice. Mice derived from a were analyzed for muscle wasting. Scale bar, 100 μm. Data (n = 6) were analyzed by analysis of variance or χ2 analysis (for CSA). * denotes a difference (P < 0.05) Image collected & cropped by CiteAb from the following publication (//www.nature.com/articles/s41467-017-00726-x), licensed under a CC-BY license. Not internally tested by Novus Biologicals.")
![Western Blot Rap1A/B Antibody [Unconjugated]](https://images.novusbio.com/images2/Rap1B_AF3767_Western_Blot_5331.jpg)
![Western Blot Rap1A/B Antibody [Unconjugated]](https://images.novusbio.com/images2/Rap1B_AF3767_Western_Blot_6316.jpg)
![Immunohistochemistry Rap1A/B Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af3767_human-mouse-rat-rap1a-b-affinity-purified-polyclonal-ab-immunohistochemistry-318202392533..jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")