![Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327] - Analysis in human heart muscle and pancreas tissues. Corresponding Pyruvate Dehydrogenase E1 beta subunit RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Pyruvate-Dehydrogenase-E1-beta-subunit-Antibody-Immunohistochemistry-Paraffin-NBP2-38327-img0012.jpg "Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327] - Analysis in human heart muscle and pancreas tissues. Corresponding Pyruvate Dehydrogenase E1 beta subunit RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, Simple Western, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: LIKSAIRDNNPVVVLENELMYGVPFEFPPEAQSKDFLIPIGKAKIERQGTHITVVSHSRPVGHCLEAAAVLSKEGVE |
| Predicted Species | Mouse (92%), Rat (91%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PDHB |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. In Simple Western internal validation: Separated by size; matrix was 12-230 kDa; detected by Chemiluminescence. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot Pyruvate Dehydrogenase E1-alpha subunit [p Ser293] Antibody - BSA Free](https://images.novusbio.com/images/Pyruvate-Dehydrogenase-E1-alpha-subunit-[p-Ser293]-Antibody-Western-Blot-NB110-93479-img0003.jpg)
![Western Blot Pyruvate Dehydrogenase E1-alpha subunit [p Ser293] Antibody - BSA Free](https://images.novusbio.com/images/Pyruvate-Dehydrogenase-E1-alpha-subunit-[p-Ser293]-Antibody-Western-Blot-NB110-93479-img0008.jpg)
![Western Blot Pyruvate Dehydrogenase E1-alpha subunit [p Ser293] Antibody - BSA Free](https://images.novusbio.com/images/Pyruvate-Dehydrogenase-E1-alpha-subunit-[p-Ser293]-Antibody-Western-Blot-NB110-93479-img0007.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Pyruvate Dehydrogenase E1 beta subunit Antibody (NBP2-38327)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327] - Staining of human cerebral cortex, heart muscle, kidney and pancreas using Anti-Pyruvate Dehydrogenase E1 beta subunit antibody NBP2-38327 (A) shows similar protein distribution across tissues to independent antibody NBP1-87421 (B).](http://images.novusbio.com/fullsize/Pyruvate-Dehydrogenase-E1-beta-subunit-Antibody-Immunohistochemistry-Paraffin-NBP2-38327-img0015.jpg "Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327] - Staining of human cerebral cortex, heart muscle, kidney and pancreas using Anti-Pyruvate Dehydrogenase E1 beta subunit antibody NBP2-38327 (A) shows similar protein distribution across tissues to independent antibody NBP1-87421 (B).")
![Western Blot: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327] - Analysis using Anti-PDHB antibody NBP2-38327 (A) shows similar pattern to independent antibody NBP1-87421 (B).](http://images.novusbio.com/fullsize/Pyruvate-Dehydrogenase-E1-beta-subunit-Antibody-Western-Blot-NBP2-38327-img0009.jpg "Western Blot: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327] - Analysis using Anti-PDHB antibody NBP2-38327 (A) shows similar pattern to independent antibody NBP1-87421 (B).")
![Immunocytochemistry/Immunofluorescence: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.](http://images.novusbio.com/fullsize/Pyruvate-Dehydrogenase-E1-beta-subunit-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38327-img0004.jpg "Immunocytochemistry/Immunofluorescence: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.")
![Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in distal tubules.](http://images.novusbio.com/fullsize/Pyruvate-Dehydrogenase-E1-beta-subunit-Antibody-Immunohistochemistry-Paraffin-NBP2-38327-img0017.jpg "Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in distal tubules.")
![Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/Pyruvate-Dehydrogenase-E1-beta-subunit-Antibody-Immunohistochemistry-Paraffin-NBP2-38327-img0006.jpg "Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327] - Staining of human kidney.](http://images.novusbio.com/fullsize/Pyruvate-Dehydrogenase-E1-beta-subunit-Antibody-Immunohistochemistry-Paraffin-NBP2-38327-img0010.jpg "Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327] - Staining of human cerebral cortex shows moderate positivity in neuropil.](http://images.novusbio.com/fullsize/Pyruvate-Dehydrogenase-E1-beta-subunit-Antibody-Immunohistochemistry-Paraffin-NBP2-38327-img0013.jpg "Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327] - Staining of human cerebral cortex shows moderate positivity in neuropil.")
![Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.](http://images.novusbio.com/fullsize/Pyruvate-Dehydrogenase-E1-beta-subunit-Antibody-Immunohistochemistry-Paraffin-NBP2-38327-img0016.jpg "Immunohistochemistry-Paraffin: Pyruvate Dehydrogenase E1 beta subunit Antibody [NBP2-38327] - Staining of human heart muscle shows strong cytoplasmic positivity in cardiomyocytes.")
![Western Blot Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Western_Blot_19121.jpg)
![Immunohistochemistry Butyrylcholinesterase/BCHE Antibody [Unconjugated]](https://images.novusbio.com/images2/Butyrylcholinesterase_AF9024_Immunohistochemistry_19158.jpg)
![Flow Cytometry S1P1/EDG-1 Antibody (713412) [Unconjugated]](https://images.novusbio.com/images2/S1P1_MAB7089_Flow_Cytometry_11459.jpg)
![Flow Cytometry S1P1/EDG-1 Antibody (713412) [Unconjugated]](https://images.novusbio.com/images2/S1P1_MAB7089_Flow_Cytometry_22010.jpg)
![Immunohistochemistry S1P1/EDG-1 Antibody (713412) [Unconjugated]](https://images.novusbio.com/images2/S1P1_MAB7089_Immunohistochemistry_12044.jpg)
![Western Blot HTRA2/Omi Antibody [Unconjugated]](https://images.novusbio.com/images2/HTRA2_AF1458_Western_Blot_5114.jpg)
![Simple Western HTRA2/Omi Antibody [Unconjugated]](https://images.novusbio.com/images2/16328.jpg)
![Immunocytochemistry HTRA2/Omi Antibody [Unconjugated]](https://images.novusbio.com/images2/HTRA2_AF1458_Immunocytochemistry_9924.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")