![Western Blot: Pyruvate Carboxylase Antibody [NBP2-33407] - Analysis in human cell lines HeLa and U-251MG. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/Pyruvate-Carboxylase-Antibody-Western-Blot-NBP2-33407-img0005.jpg "Western Blot: Pyruvate Carboxylase Antibody [NBP2-33407] - Analysis in human cell lines HeLa and U-251MG. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: GADVVDVAADSMSGMTSQPSMGALVACTRGTPLDTEVPMERVFDYSEYWEGARGLYAAFDCTATMKSGNSDVYENEIPGGQYTNLHFQ |
| Predicted Species | Rat (97%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PC |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP2-33407 | Applications | Species |
|---|---|---|
| Simone Cardaci, Liang Zheng, Gillian MacKay et al. Pyruvate carboxylation enables growth of SDH-deficient cells by supporting aspartate biosynthesis. Nature Cell Biology 2015-08-24 [PMID: 26302408] (IF/IHC, Mouse) | IF/IHC | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for Pyruvate Carboxylase Antibody (NBP2-33407)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: Pyruvate Carboxylase Antibody [NBP2-33407] - Staining of human cell line A549 shows localization to mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Pyruvate-Carboxylase-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-33407-img0004.jpg "Immunocytochemistry/Immunofluorescence: Pyruvate Carboxylase Antibody [NBP2-33407] - Staining of human cell line A549 shows localization to mitochondria. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Pyruvate Carboxylase Antibody [NBP2-33407] - Staining of human lymph node shows no positivity in germinal center cells as expected.](http://images.novusbio.com/fullsize/Pyruvate-Carboxylase-Antibody-Immunohistochemistry-Paraffin-NBP2-33407-img0011.jpg "Immunohistochemistry-Paraffin: Pyruvate Carboxylase Antibody [NBP2-33407] - Staining of human lymph node shows no positivity in germinal center cells as expected.")
![Immunohistochemistry-Paraffin: Pyruvate Carboxylase Antibody [NBP2-33407] - Analysis in human liver and lymph node tissues. Corresponding PC RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Pyruvate-Carboxylase-Antibody-Immunohistochemistry-Paraffin-NBP2-33407-img0007.jpg "Immunohistochemistry-Paraffin: Pyruvate Carboxylase Antibody [NBP2-33407] - Analysis in human liver and lymph node tissues. Corresponding PC RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Pyruvate Carboxylase Antibody [NBP2-33407] - Staining of human cerebellum shows strong granular cytoplasmic positivity in cells in granular layer.](http://images.novusbio.com/fullsize/Pyruvate-Carboxylase-Antibody-Immunohistochemistry-Paraffin-NBP2-33407-img0008.jpg "Immunohistochemistry-Paraffin: Pyruvate Carboxylase Antibody [NBP2-33407] - Staining of human cerebellum shows strong granular cytoplasmic positivity in cells in granular layer.")
![Immunohistochemistry-Paraffin: Pyruvate Carboxylase Antibody [NBP2-33407] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in proximal tubules.](http://images.novusbio.com/fullsize/Pyruvate-Carboxylase-Antibody-Immunohistochemistry-Paraffin-NBP2-33407-img0009.jpg "Immunohistochemistry-Paraffin: Pyruvate Carboxylase Antibody [NBP2-33407] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in proximal tubules.")
![Immunohistochemistry-Paraffin: Pyruvate Carboxylase Antibody [NBP2-33407] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/Pyruvate-Carboxylase-Antibody-Immunohistochemistry-Paraffin-NBP2-33407-img0010.jpg "Immunohistochemistry-Paraffin: Pyruvate Carboxylase Antibody [NBP2-33407] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Complement Component C2 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Complement Component C2 Antibody [Unconjugated]")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunocytochemistry Glucagon Antibody (181402) [Unconjugated]](https://images.novusbio.com/images2/Glucagon_MAB1249_Immunocytochemistry_6560.jpg)
![Intracellular Staining by Flow Cytometry Glucagon Antibody (181402) [Unconjugated]](https://images.novusbio.com/images2/Glucagon_MAB1249_Flow_Cytometry_20264.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")