Home » PRPS1 » PRPS1 Proteins » PRPS1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

PRPS1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for PRPS1 Protein (NBP2-13813PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

PRPS1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRPS1.

Source: E. coli

Amino Acid Sequence: LHASQIQVSVEAKYWCLKGGRKGLMMLKTAEKP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRPS1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-13813.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PRPS1 Recombinant Protein Antigen

  • CMTX5
  • CMTX5ARTS
  • deafness, X-linked 2, perceptive, congenital
  • DFN2
  • DFNX1
  • DFNX1KIAA0967
  • dJ1070B1.2 (phosphoribosyl pyrophosphate synthetase 1)
  • EC 2.7.6.1
  • Phosphoribosyl pyrophosphate synthase I
  • phosphoribosyl pyrophosphate synthetase 1
  • PPRibP
  • PRPS1
  • PRS I
  • PRSI
  • PRS-I
  • ribose-phosphate diphosphokinase 1
  • ribose-phosphate pyrophosphokinase 1

Background

The PRPS1 gene encodes an enzyme that catalyzes the phosphoribosylation of ribose 5-phosphate to 5-phosphoribosyl-1-pyrophosphate, which is necessary for purine metabolism and nucleotide biosynthesis. Defects in this gene are a cause of phosphoribosylpyrophosp

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

XIAP Antibody
[Unconjugated]
AF8221
Western Blot XIAP Antibody [Unconjugated]
Simple Western XIAP Antibody [Unconjugated]
Knockout Validated XIAP Antibody [Unconjugated]
(23 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
HPRT Antibody
NBP1-33527
Western Blot HPRT Antibody
Western Blot HPRT Antibody
Immunohistochemistry-Paraffin HPRT Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
PRPS2 Antibody
NBP1-31435
Knockdown Validated PRPS2 Antibody
Immunohistochemistry PRPS2 Antibody
Immunocytochemistry/ Immunofluorescence PRPS2 Antibody
(4 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Serpin A5/Protein
C Inhibitor Antibody ...
MAB1266
Intracellular Staining by Flow Cytometry Serpin A5/Protein C Inhibitor Antibody (210326) [Unconjugated]
(2 Publications)
Species: Hu
Applications: CyTOF-ready, IP, ICFlow, WB
Glycophorin A
Antibody (R10) [Uncon ...
MAB1228
Immunohistochemistry Glycophorin A Antibody (R10) [Unconjugated]
Flow Cytometry Glycophorin A Antibody (R10) [Unconjugated]
(5 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP
BRN4 Antibody
NBP2-68787
Immunocytochemistry/ Immunofluorescence BRN4 Antibody
Western Blot BRN4 Antibody
Species: Hu
Applications: ICC/IF, WB
STK36 Antibody
NBP1-83411
Immunocytochemistry/ Immunofluorescence STK36 Antibody
Immunohistochemistry-Paraffin STK36 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Bcl-xL Antibody
NB100-56104
Western Blot Bcl-xL Antibody
Immunohistochemistry-Paraffin Bcl-xL Antibody
Western Blot Bcl-xL Antibody
(1 Review)
(3 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Adenosine
Deaminase/ADA Antibod
NBP1-87404
Immunohistochemistry-Paraffin Adenosine Deaminase/ADA Antibody
Immunohistochemistry-Paraffin Adenosine Deaminase/ADA Antibody
Immunocytochemistry/ Immunofluorescence Adenosine Deaminase/ADA Antibody
(4 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
CRAT Antibody
NBP1-86616
Western Blot CRAT Antibody
Western Blot CRAT Antibody
Immunohistochemistry-Paraffin CRAT Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
SMAC/Diablo
Antibody
NB100-56311
Western Blot SMAC/Diablo Antibody
Immunohistochemistry SMAC/Diablo Antibody
(16 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
GLYAT Antibody
NBP2-58917
Western Blot GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Desmin Antibody
[Unconjugated]
AF3844
Immunohistochemistry Desmin Antibody [Unconjugated]
Immunohistochemistry Desmin Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence Desmin Antibody [Unconjugated]
(2 Reviews)
(34 Publications)
Species: Hu, Mu
Applications: IHC
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NHS Antibody (6D9)
H00004810-M05
ELISA NHS Antibody (6D9)
Immunocytochemistry/ Immunofluorescence NHS Antibody (6D9)
Species: Hu
Applications: ELISA, ICC/IF, WB
Purine Nucleoside
Phosphorylase/PNP Ant ...
NBP1-82541
Western Blot Purine Nucleoside Phosphorylase/PNP Antibody
Immunohistochemistry-Paraffin Purine Nucleoside Phosphorylase/PNP Antibody
Immunohistochemistry-Paraffin Purine Nucleoside Phosphorylase/PNP Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
PSP94/MSMB
Antibody (OTI6C7)
NBP2-02450
Western Blot PSP94/MSMB Antibody (OTI6C7)
Immunocytochemistry/ Immunofluorescence PSP94/MSMB Antibody (OTI6C7)
Immunohistochemistry-Paraffin PSP94/MSMB Antibody (OTI6C7)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MCAT Antibody (2F2)
H00027349-M01
Immunohistochemistry-Paraffin MCAT Antibody (2F2)
Western Blot MCAT Antibody (2F2)
Sandwich ELISA MCAT Antibody (2F2)
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB

Publications for PRPS1 Protein (NBP2-13813PEP) (0)

There are no publications for PRPS1 Protein (NBP2-13813PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PRPS1 Protein (NBP2-13813PEP) (0)

There are no reviews for PRPS1 Protein (NBP2-13813PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PRPS1 Protein (NBP2-13813PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PRPS1 Products

Research Areas for PRPS1 Protein (NBP2-13813PEP)

Find related products by research area.

Blogs on PRPS1

There are no specific blogs for PRPS1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Desmin was detected in immersion fixed frozen sections of mouse skeletal muscle using Human Desmin Antigen Affinity-purified Polyclonal Antibody (Catalog # AF3844) at 10 µg/mL overnight at 4 °C. Tissue was stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to z-lines. View our protocol for Fluorescent IHC Staining of Frozen Tissue Sections.
Desmin Antibody [Unconjugated]
AF3844

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PRPS1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PRPS1