Home » PPP1R3A » PPP1R3A Proteins » PPP1R3A Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

PPP1R3A Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for PPP1R3A Recombinant Protein Antigen (NBP3-21334PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

PPP1R3A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PPP1R3A

Source: E.coli

Amino Acid Sequence: CNSTREIQGIEKHPYPESKPEEVSRSSGIVTSGSRKERCIGQIFQTEEYSVEKSLGPMILINKPLENMEEARHENEGLVSSGQSLYTSGEKESDSSASTSLPVEESQAQGNESLFS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PPP1R3A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-21334. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here.
Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PPP1R3A Recombinant Protein Antigen

  • glycogen and sarcoplasmic reticulum binding subunit, skeletal muscle
  • GM
  • PP1G
  • PPP1R3
  • protein phosphatase 1 glycogen- associated regulatory subunit
  • Protein phosphatase 1 glycogen-associated regulatory subunit
  • protein phosphatase 1 regulatory subunit 3A
  • protein phosphatase 1, regulatory (inhibitor) subunit 3A (glycogen andsarcoplasmic reticulum binding subunit, skeletal muscle)
  • protein phosphatase 1, regulatory (inhibitor) subunit 3A
  • Protein phosphatase type-1 glycogen targeting subunit
  • RG1
  • serine /threonine specific protein phosphatase
  • type-1 protein phosphatase skeletal muscle glycogen targeting subunit

Background

The glycogen-associated form of protein phosphatase-1 (PP1) derived from skeletal muscle is a heterodimer composed of a 37-kD catalytic subunit and a 124-kD targeting and regulatory subunit. This gene encodes the regulatory subunit which binds to muscle glycogen with high affinity, thereby enhancing dephosphorylation of glycogen-bound substrates for PP1 such as glycogen synthase and glycogen phosphorylase kinase. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

GM-CSF
[Unconjugated]
7954-GM/CF
Bioactivity GM-CSF [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
GM-CSF
[Unconjugated]
7954-GM/CF
Bioactivity GM-CSF [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(807 Publications)
Species: Hu
Applications: BA
IL-3 [Unconjugated]
203-IL
SDS-PAGE IL-3 [Unconjugated]
Bioactivity IL-3 [Unconjugated]
SEC-MALS IL-3 [Unconjugated]
(204 Publications)
Species: Hu
Applications: BA
LAMC2 Antibody
(CL2980)
NBP2-42388
Western Blot LAMC2 Antibody (CL2980)
Immunohistochemistry-Paraffin LAMC2 Antibody (CL2980)
Immunohistochemistry-Paraffin LAMC2 Antibody (CL2980)
(4 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Erythropoietin/EPO
[HRP]
MEP00B
N/A Erythropoietin/EPO [HRP]
N/A Erythropoietin/EPO [HRP]
(104 Publications)
Species: Mu
Applications: ELISA
SCF/c-kit Ligand
[Unconjugated]
255-SC
SCF/c-kit Ligand [Unconjugated]
(195 Publications)
Species: Hu
Applications: BA
G-CSF Antibody
(67604) [Unconjugated
MAB414
Neutralization G-CSF Antibody (67604) [Unconjugated]
(58 Publications)
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB
IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
G-CSF Antibody
(67604) [Unconjugated
MAB414
Neutralization G-CSF Antibody (67604) [Unconjugated]
(58 Publications)
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), Neut, WB
PPP1R3B Antibody
H00079660-B01P
Immunocytochemistry/ Immunofluorescence PPP1R3B Antibody
Western Blot PPP1R3B Antibody
Western Blot PPP1R3B Antibody
(1 Publication)
Species: Hu, Rt
Applications: ICC/IF, WB
IL-1 beta/IL-1F2
[Unconjugated]
201-LB
SDS-PAGE IL-1 beta/IL-1F2 [Unconjugated]
Bioactivity IL-1 beta/IL-1F2 [Unconjugated]
SEC-MALS IL-1 beta/IL-1F2 [Unconjugated]
(575 Publications)
Species: Hu
Applications: BA
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(370 Publications)
Species: Hu
Applications: BA
IFN-gamma
[Unconjugated]
285-IF
Bioactivity IFN-gamma [Unconjugated]
SDS-PAGE IFN-gamma [Unconjugated]
SEC-MALS IFN-gamma [Unconjugated]
(2 Reviews)
(445 Publications)
Species: Hu
Applications: BA
FGF
basic/FGF2/bFGF [Unco
233-FB
FGF basic/FGF2/bFGF [Unconjugated]
(531 Publications)
Species: Hu
Applications: BA
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Gastric Lipase
Antibody - BSA Free
NB110-60930
Western Blot Gastric Lipase Antibody - BSA Free
Species: Hu, Mu
Applications: WB

Publications for PPP1R3A Recombinant Protein Antigen (NBP3-21334PEP) (0)

There are no publications for PPP1R3A Recombinant Protein Antigen (NBP3-21334PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPP1R3A Recombinant Protein Antigen (NBP3-21334PEP) (0)

There are no reviews for PPP1R3A Recombinant Protein Antigen (NBP3-21334PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PPP1R3A Recombinant Protein Antigen (NBP3-21334PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PPP1R3A Products

Blogs on PPP1R3A

There are no specific blogs for PPP1R3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PPP1R3A Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PPP1R3A