PP1 Inhibitor-2 Antibody (2E9) Summary
Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
Immunogen |
PPP1R2 (NP_006232, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAASTASHRPIKGILKNKTSTTSSMVASAEQPRGNVDEELSKKSQKWDEMNILATYHPADKDYGLMKIDEPSTPYHSMMGDDEDACSDTEATEAMAPDIL |
Specificity |
PPP1R2 - protein phosphatase 1, regulatory (inhibitor) subunit 2 |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
PPP1R2 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunohistochemistry
- Immunohistochemistry-Paraffin
- Sandwich ELISA
- Western Blot 1:500
|
Application Notes |
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for PP1 Inhibitor-2 Antibody (2E9)
Background
Inhibitor-2 (I-2) exists as a heterodimer with protein phosphatase type-1 (PP1), termed MgATP-dependent phosphatase. I-2 binds and forms an inactive complex with PP1 in its unphosphorylated state. This complex is activated through a series of phosphorylations on serine and threonine residues in I-2 that increases phosphatase activity. Multiple kinases have been implicated in phosphorylation of I-2 at threonine 72, namely GSK-3, cdc2 and ERK1. Casein kinase II phosphorylates I-2 at serine residues, which in turn enhances threonine phosphorylation by GSK-3.
Recent evidence has shown that phosphorylation at threonine 72 peaks during prophase of the cell cycle and is localized in the centrosomes. The I-2/PP1 complex also binds neurabin and the kinases Nek2, KPI-2, and Aurora-A. Regulation of I-2/PP1 has been shown to be important in cell cycle,
gene expression, ion gating, and neuromodulation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Ca, Eq, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Ca, Ch, ChHa, Fe, Hu, Mu, Ma-Op, Po, Pm, Rt
Applications: ICC/IF, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB, ELISA, IHC
Publications for PP1 Inhibitor-2 Antibody (H00005504-M01) (0)
There are no publications for PP1 Inhibitor-2 Antibody (H00005504-M01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PP1 Inhibitor-2 Antibody (H00005504-M01) (0)
There are no reviews for PP1 Inhibitor-2 Antibody (H00005504-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PP1 Inhibitor-2 Antibody (H00005504-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PP1 Inhibitor-2 Products
Research Areas for PP1 Inhibitor-2 Antibody (H00005504-M01)
Find related products by research area.
|
Blogs on PP1 Inhibitor-2