![Western Blot: POLR2C Antibody [NBP1-80817] - Analysis using Anti-POLR2C antibody NBP1-80817 (A) shows similar pattern to independent antibody NBP1-80818 (B).](http://images.novusbio.com/fullsize/POLR2C-Antibody-Western-Blot-NBP1-80817-img0014.jpg "Western Blot: POLR2C Antibody [NBP1-80817] - Analysis using Anti-POLR2C antibody NBP1-80817 (A) shows similar pattern to independent antibody NBP1-80818 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERFYYNVESCGSLRPETIVLSALSGLKKKLSDLQTQLSHEIQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | POLR2C |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-80817 | Applications | Species |
|---|---|---|
| Shearn CT, Anderson AL, Devereux MW et al. The autophagic protein p62 is a target of reactive aldehydes in human and murine cholestatic liver disease PloS one 2022-11-15 [PMID: 36378690] (IHC-P, Mouse) | IHC-P | Mouse |
Secondary Antibodies |
Isotype Controls |
Research Areas for POLR2C Antibody (NBP1-80817)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: POLR2C Antibody [NBP1-80817] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & microtubules.](http://images.novusbio.com/fullsize/POLR2C-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-80817-img0011.jpg "Immunocytochemistry/Immunofluorescence: POLR2C Antibody [NBP1-80817] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & microtubules.")
![Immunohistochemistry-Paraffin: POLR2C Antibody [NBP1-80817] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/POLR2C-Antibody-Immunohistochemistry-Paraffin-NBP1-80817-img0017.jpg "Immunohistochemistry-Paraffin: POLR2C Antibody [NBP1-80817] - Staining of human cerebral cortex.")
![Western Blot: POLR2C Antibody [NBP1-80817] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/POLR2C-Antibody-Western-Blot-NBP1-80817-img0008.jpg "Western Blot: POLR2C Antibody [NBP1-80817] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
![Immunohistochemistry: POLR2C Antibody [NBP1-80817] - Staining of human ovary shows nuclear positivity.](http://images.novusbio.com/fullsize/POLR2C-Antibody-Immunohistochemistry-NBP1-80817-img0012.jpg "Immunohistochemistry: POLR2C Antibody [NBP1-80817] - Staining of human ovary shows nuclear positivity.")
![Immunohistochemistry-Paraffin: POLR2C Antibody [NBP1-80817] - Staining of human cerebral cortex, colon, kidney and testis using Anti-POLR2C antibody NBP1-80817 (A) shows similar protein distribution across tissues to independent antibody NBP1-80818 (B).](http://images.novusbio.com/fullsize/POLR2C-Antibody-Immunohistochemistry-Paraffin-NBP1-80817-img0013.jpg "Immunohistochemistry-Paraffin: POLR2C Antibody [NBP1-80817] - Staining of human cerebral cortex, colon, kidney and testis using Anti-POLR2C antibody NBP1-80817 (A) shows similar protein distribution across tissues to independent antibody NBP1-80818 (B).")
![Immunohistochemistry-Paraffin: POLR2C Antibody [NBP1-80817] - Staining of human testis.](http://images.novusbio.com/fullsize/POLR2C-Antibody-Immunohistochemistry-Paraffin-NBP1-80817-img0015.jpg "Immunohistochemistry-Paraffin: POLR2C Antibody [NBP1-80817] - Staining of human testis.")
![Immunohistochemistry-Paraffin: POLR2C Antibody [NBP1-80817] - Staining of human colon.](http://images.novusbio.com/fullsize/POLR2C-Antibody-Immunohistochemistry-Paraffin-NBP1-80817-img0016.jpg "Immunohistochemistry-Paraffin: POLR2C Antibody [NBP1-80817] - Staining of human colon.")
![Immunohistochemistry-Paraffin: POLR2C Antibody [NBP1-80817] - Staining of human kidney.](http://images.novusbio.com/fullsize/POLR2C-Antibody-Immunohistochemistry-Paraffin-NBP1-80817-img0018.jpg "Immunohistochemistry-Paraffin: POLR2C Antibody [NBP1-80817] - Staining of human kidney.")
![N/A IGFBP-3 [HRP]](https://images.novusbio.com/images2/DATA_IGFBP3_DGB300_ELISA_694.jpg)
![N/A IGFBP-3 [HRP]](https://images.novusbio.com/images2/IGFBP-3_DGB300_ELISA_104.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")