Home » Plexin A3 » Plexin A3 Proteins » Plexin A3 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Plexin A3 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Plexin A3 Recombinant Protein Antigen (NBP2-56699PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Plexin A3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Plexin A3.

Source: E. coli

Amino Acid Sequence: SSLDAGSRVTVTVRDSECQFVRRDAKAIVCISPLSTLGPSQAPITLAIDRANISSPGLIYTYTQDPTVTRLEPTWSIINGSTA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PLXNA3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56699.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Plexin A3 Recombinant Protein Antigen

  • HSSEXGENE
  • Plexin A3
  • plexin-4
  • plexin-A3
  • Plxn3
  • PLXN4
  • PLXNA3
  • Semaphorin receptor SEX
  • Sex chromosome X transmembrane protein of HGF receptor family 3
  • SEX
  • SEXPLEXIN-A3,6.3
  • XAP-6

Background

Plexin A3, also known by its gene name PLXNA3, has 1,871 amino acids and is approximately 208kDa. Plexin A3 is a cell surface, transmembrane protein that is a member of the Plexin family. Plexin A3 is thought to play a role in the development of neural tissue and epithelial tissue, as well as function in axon guidance. Current research on Plexin A3 is being performed in relation to several diseases and disorders including Rett syndrome, neuronitis and ovarian cancer. Plexin A3 has also been shown to have interactions with SMN1, SMN2, MAPK8IP2, CBFA2T3 and CSNK2B in pathways such as the axon guidance pathway and the Semaphorin signaling pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Semaphorin 3A
[Unconjugated]
1250-S3
Bioactivity Semaphorin 3A [Unconjugated]
(34 Publications)
Species: Hu
Applications: BA, BA
Plexin A1 Antibody
[Unconjugated]
AF4309
Immunohistochemistry Plexin A1 Antibody [Unconjugated]
Immunocytochemistry Plexin A1 Antibody [Unconjugated]
Western Blot Plexin A1 Antibody [Unconjugated]
(12 Publications)
Species: Hu, Mu
Applications: ICC, IHC, WB
Neuropilin-1
Antibody [Unconjugate
AF566
Immunohistochemistry Neuropilin-1 Antibody [Unconjugated]
Immunohistochemistry Neuropilin-1 Antibody [Unconjugated]
Western Blot Neuropilin-1 Antibody [Unconjugated]
(10 Reviews)
(108 Publications)
Species: Mu, Rt
Applications: Block, CyTOF-ready, Flow, IHC, WB
Plexin A4 Antibody
NBP1-85128
Immunohistochemistry-Paraffin Plexin A4 Antibody
(1 Review)
(4 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Neuropilin-2
Antibody [Unconjugate
AF567
Immunohistochemistry Neuropilin-2 Antibody [Unconjugated]
Western Blot Neuropilin-2 Antibody [Unconjugated]
Simple Western Neuropilin-2 Antibody [Unconjugated]
(4 Reviews)
(39 Publications)
Species: Mu, Rt
Applications: Block, IHC, Simple Western, WB
Semaphorin 3F
[Unconjugated]
3237-S3
Semaphorin 3F [Unconjugated]
(8 Publications)
Species: Mu
Applications: BA
Plexin A2 Antibody
[Unconjugated]
AF5486
Immunocytochemistry Plexin A2 Antibody [Unconjugated]
Immunocytochemistry Plexin A2 Antibody [Unconjugated]
Simple Western Plexin A2 Antibody [Unconjugated]
(5 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, Simple Western, WB
Plexin B1 Antibody
[Unconjugated]
AF3749
Plexin B1 Antibody [Unconjugated]
(6 Publications)
Species: Hu
Applications: IHC, WB
Semaphorin 3B
Antibody
NB100-2218
Simple Western Semaphorin 3B Antibody
Western Blot Semaphorin 3B Antibody
Immunocytochemistry/ Immunofluorescence Semaphorin 3B Antibody
(2 Publications)
Species: Bv, Ca, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NELL1 Antibody
AF7109
Western Blot NELL1 Antibody
Immunohistochemistry NELL1 Antibody
Species: Mu
Applications: IHC, WB
NELL2 Antibody
NBP1-82527
Immunohistochemistry NELL2 Antibody
Immunohistochemistry-Paraffin NELL2 Antibody
Immunohistochemistry-Paraffin NELL2 Antibody
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Plexin C1 Antibody
[Unconjugated]
AF5375
Western Blot Plexin C1 Antibody [Unconjugated]
Immunohistochemistry Plexin C1 Antibody [Unconjugated]
Flow Cytometry Plexin C1 Antibody [Unconjugated]
(8 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
Semaphorin
4D/CD100 Antibody [Un ...
AF5235
Flow Cytometry Semaphorin 4D/CD100 Antibody [Unconjugated]
Immunohistochemistry Semaphorin 4D/CD100 Antibody [Unconjugated]
(1 Publication)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
Semaphorin 6A
Antibody [Unconjugate
AF1615
Immunohistochemistry Semaphorin 6A Antibody [Unconjugated]
(7 Publications)
Species: Mu
Applications: IHC, WB
MMP-2 [HRP]
MMP200
N/A MMP-2 [HRP]
N/A MMP-2 [HRP]
(101 Publications)
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
Neuronal Pentraxin
2 Antibody - BSA Free ...
NBP1-76899
Immunohistochemistry Neuronal Pentraxin 2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Neuronal Pentraxin 2 Antibody - BSA Free
Immunohistochemistry-Paraffin Neuronal Pentraxin 2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
alpha Adducin
Antibody
NBP2-38268
Immunohistochemistry-Paraffin alpha Adducin Antibody
Immunohistochemistry-Paraffin alpha Adducin Antibody
Immunohistochemistry-Paraffin alpha Adducin Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Plexin A3
Recombinant Protein A
NBP2-56699PEP
Plexin A3 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Plexin A3 Recombinant Protein Antigen (NBP2-56699PEP) (0)

There are no publications for Plexin A3 Recombinant Protein Antigen (NBP2-56699PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Plexin A3 Recombinant Protein Antigen (NBP2-56699PEP) (0)

There are no reviews for Plexin A3 Recombinant Protein Antigen (NBP2-56699PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Plexin A3 Recombinant Protein Antigen (NBP2-56699PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Plexin A3 Products

Research Areas for Plexin A3 Recombinant Protein Antigen (NBP2-56699PEP)

Find related products by research area.

Blogs on Plexin A3

There are no specific blogs for Plexin A3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Plexin A3 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PLXNA3