Novus Biologicals products are now on bio-techne.com

PLEC1 Recombinant Protein Antigen

Images

 
There are currently no images for PLEC1 Protein (NBP1-92275PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

PLEC1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PLCE1.

Source: E. coli

Amino Acid Sequence: MGISPLGNQSVIIETGRAHPDSRRAVFHFHYEVDRRMSDTFCTLSENLILDDCGNCVPLPGGEEKQKKNYVAYTCKLMELAKNCDNKNEQLQCDHCDTLNDKYFCFEGSCEKVDMVYSGDSFCRKDFTDSQAAKT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PLCE1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-92275.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PLEC1 Recombinant Protein Antigen

  • KIAA1516
  • phospholipase C, epsilon 1
  • PLCE
  • PLCE1
  • PLC-epsilon-1
  • PLEC1
  • PPLC

Background

The PLEC1 gene (also known as the PLEC gene) encodes a plectin protein that exists in nine isoforms: isoform 1 is 4,684 amino acids long at 531 kDA; isoform 2 is 4,574 amino acids long at 518 kDA; isoform 3 is 4,570 amino acids long at 518 kDA; isoform 4 is 4,547 amino acids long at 516 kDA; isoform 5 is 4,547 amino acids long at 516 kDA; isoform 6 is 4,551 amino acids long at 516 kDA; isoform 7 is 4,515 amino acids long at 512 kDA; isoform 8 is 4,525 amino acids long at 513 kDA; and isoform 9 is 4,533 amino acids long at 514 kDA. The PLEC1 gene functions as a structural component of muscle as links intermediate filaments with microtubules and microfilaments. It anchors the intermediate filaments to desmosomes or hemidesmosomes. Additionally, it is thought to have the ability to bind muscle proteins, like actin, to membrane complexes in the muscle. PLEC1 participates in cytoskeletal signaling, cytoskeleton remodeling of neurofilaments and keratin filaments, EGFR1 signaling pathways, apoptosis, collagen formation, and Alpha6-Beta4 integrin signaling pathways. It is known to interact with genes SRRM2, SQSTM1, GRB2, ITGB4, and RANBP2. Defects in this gene lead to epidermolysis bullosa simplex with pyloric atresia (EBS-PA), epidermolysis bullosa simplex with muscular dystrophy (MD-EBS), epidermolysis bullosa simplex Ogna type (O-EBS) and limb-girdle muscular dystrophy type 2Q (LGMD2Q). PLEC1 is also associated with myopathy, neuropathy, alexander disease, myasthenic syndrome, squamous cell carcinoma, epithelial ovarian cancer, and muscular dystrophy.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-52533
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF3159
Species: Mu
Applications: IHC
NBP2-75624
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, MI, WB
NB110-60011
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
H00000081-M01
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-90625
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-61818
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-44751
Species: Bv, Hu, Mu
Applications: Flow, ICC/IF, IF, IHC, IHC-Fr, IHC-P
MAB2066
Species: Ch, Hu, Rt
Applications: ICC, IP, WB
NBP1-77260
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-94035
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
H00008826-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
NBP1-47668
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-59438
Species: Hu
Applications: ELISA, ICC/IF, WB
DAN00
Species: Hu
Applications: ELISA
NBP1-92275PEP
Species: Hu
Applications: AC

Publications for PLEC1 Protein (NBP1-92275PEP) (0)

There are no publications for PLEC1 Protein (NBP1-92275PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PLEC1 Protein (NBP1-92275PEP) (0)

There are no reviews for PLEC1 Protein (NBP1-92275PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PLEC1 Protein (NBP1-92275PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PLEC1 Products

Array NBP1-92275PEP

Research Areas for PLEC1 Protein (NBP1-92275PEP)

Find related products by research area.

Blogs on PLEC1

There are no specific blogs for PLEC1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PLEC1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PLCE1