PLA2R1 Antibody (CL0474) Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID |
Epitope |
KIPVSFEWSN |
Isotype |
IgG1 |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
PLA2R1 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 2-10 ug/ml
- Immunohistochemistry 1:20000 - 1:50000
- Immunohistochemistry-Paraffin 1:20000 -1:50000
- Western Blot 1 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Protein A purified |
Alternate Names for PLA2R1 Antibody (CL0474)
Background
Secretory phospholipases A2 (PLA2s) have been purified from a variety of mammalian tissues as well as from insect and snake venoms. The prototype group I PLA2, the pancreatic PLA2 (PLA2G1B; MIM 172410), is involved in digestion, smooth muscle contraction, and cell proliferation. The prototype group II PLA2, the inflammatory-type PLA2 (PLA2G2A; MIM 172411), is involved in inflammatory conditions and is upregulated by proinflammatory cytokines like tumor necrosis factor (TNF; MIM 191160) and interleukin-1 (e.g., IL1B; MIM 147720). Differential toxicity of snake venom Pla2 appears to be linked to a variety of high-affinity receptors in different organs (Ancian et al., 1995 (PubMed 7721806)).(supplied by OMIM)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IP, WB
Species: Mu
Applications: IHC, Simple Western, WB
Species: Hu, Rt
Applications: WB
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Publications for PLA2R1 Antibody (NBP2-52933) (0)
There are no publications for PLA2R1 Antibody (NBP2-52933).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for PLA2R1 Antibody (NBP2-52933) (0)
There are no reviews for PLA2R1 Antibody (NBP2-52933).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for PLA2R1 Antibody (NBP2-52933) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional PLA2R1 Products
Blogs on PLA2R1