Home » PKC beta » PKC beta Proteins » PKC beta Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

PKC beta Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for PKC beta Protein (NBP2-38579PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

PKC beta Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PRKCB.

Source: E. coli

Amino Acid Sequence: EKLERKEIQPPYKPKARDKRDTSNFDKEFTRQPVELTPTDKLFIMNLDQNEFAGFSYTNPEFVIN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PRKCB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38579.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PKC beta Recombinant Protein Antigen

  • EC 2.7.11
  • EC 2.7.11.13
  • MGC41878
  • PKC-B
  • PKC-beta
  • PKCBPRKCB2
  • PRKCB1protein kinase C beta 1
  • protein kinase C beta type
  • protein kinase C, beta 1 polypeptide
  • protein kinase C, beta 1
  • protein kinase C, beta

Background

PKCbetaII is a member of the serine/threonine protein kinase C (PKC) family (1) that includes 10 closely related isozymes classified as the

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PRRT2 Antibody -
BSA Free
NBP2-82026
Western Blot PRRT2 Antibody - BSA Free
Immunohistochemistry PRRT2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PRRT2 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
PKC alpha Antibody
(MC5)
NB600-201
Immunocytochemistry/ Immunofluorescence PKC alpha Antibody (MC5)
Immunohistochemistry-Paraffin PKC alpha Antibody (MC5)
Immunohistochemistry-Paraffin PKC alpha Antibody (MC5)
(1 Review)
(27 Publications)
Species: Pm, Bv, Ca, Ch, Fi, Hu, Pm, Mu, Po, Rb, Rt, Sh, Ze
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, RIA, WB
PKC zeta Antibody
(453513)
MAB6666
Western Blot PKC zeta Antibody (453513)
(1 Review)
Species: Hu
Applications: WB
PKC gamma Antibody
NBP1-32535
Western Blot PKC gamma Antibody
Immunohistochemistry-Frozen PKC gamma Antibody
Immunohistochemistry-Paraffin PKC gamma Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
VEGF [HRP]
DVE00
N/A VEGF [HRP]
N/A VEGF [HRP]
N/A VEGF [HRP]
(684 Publications)
Species: Hu
Applications: ELISA
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(817 Publications)
Species: Hu
Applications: BA
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Tyrosinase
Antibody (JA52-11)
NBP2-67232
Immunocytochemistry/ Immunofluorescence Tyrosinase Antibody (JA52-11)
Immunocytochemistry/ Immunofluorescence Tyrosinase Antibody (JA52-11)
Immunohistochemistry-Paraffin Tyrosinase Antibody (JA52-11)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Dystroglycan
Antibody [Unconjugate
AF6868
Immunohistochemistry Dystroglycan Antibody [Unconjugated]
Western Blot Dystroglycan Antibody [Unconjugated]
Knockout Validated Dystroglycan Antibody [Unconjugated]
(23 Publications)
Species: Hu
Applications: IHC, KO, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
IL-2 [Unconjugated]
202-IL
Bioactivity IL-2 [Unconjugated]
(4 Reviews)
(377 Publications)
Species: Hu
Applications: BA
PKC epsilon
Antibody [Unconjugate
AF5134
Immunohistochemistry PKC epsilon Antibody [Unconjugated]
Western Blot PKC epsilon Antibody [Unconjugated]
Western Blot PKC epsilon Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
(1 Review)
(20 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
PKC delta Antibody
NBP1-90351
Immunocytochemistry/ Immunofluorescence PKC delta Antibody
Immunohistochemistry-Paraffin PKC delta Antibody
Immunohistochemistry-Paraffin PKC delta Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NCF1 Antibody
NB100-790
Western Blot NCF1 Antibody
Immunofluorescence NCF1 Antibody
Flow Cytometry NCF1 Antibody
(5 Publications)
Species: Ba, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, IHC-P, IP, PEP-ELISA, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
Fibronectin
Antibody - BSA Free
NBP1-91258
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
Western Blot Fibronectin Antibody - BSA Free
(11 Reviews)
(56 Publications)
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
PKC beta
Recombinant Protein A
NBP2-38579PEP
PKC beta Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for PKC beta Protein (NBP2-38579PEP) (0)

There are no publications for PKC beta Protein (NBP2-38579PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PKC beta Protein (NBP2-38579PEP) (0)

There are no reviews for PKC beta Protein (NBP2-38579PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PKC beta Protein (NBP2-38579PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PKC beta Products

Research Areas for PKC beta Protein (NBP2-38579PEP)

Find related products by research area.

Blogs on PKC beta

There are no specific blogs for PKC beta, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our PKC beta Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PRKCB