![Western Blot: PFDN5 Antibody [NBP2-94869] - Analysis of extracts of various cell lines, using PFDN5 . Exposure time: 90s.](http://images.novusbio.com/fullsize/PFDN5-Antibody-Western-Blot-NBP2-94869-img0003.jpg "Western Blot: PFDN5 Antibody [NBP2-94869] - Analysis of extracts of various cell lines, using PFDN5 . Exposure time: 90s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-154 of human PFDN5 (NP_002615.2). MAQSINITELNLPQLEMLKNQLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKIQQLTALGAAQATAKA |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PFDN5 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.01% Thimerosal |
| Purity | Affinity purified |
![Choline Kinase beta [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Choline Kinase beta [Unconjugated]")
![Immunohistochemistry-Paraffin KAP1 [p Ser824] Antibody](https://images.novusbio.com/images/KAP1-[p-Ser824]-Antibody-Immunohistochemistry-Paraffin-NB100-2350-img0013.jpg)
![Immunohistochemistry-Paraffin KAP1 [p Ser824] Antibody](https://images.novusbio.com/images/KAP1-[p-Ser824]-Antibody-Immunohistochemistry-Paraffin-NB100-2350-img0014.jpg)
![Immunocytochemistry/ Immunofluorescence KAP1 [p Ser824] Antibody](https://images.novusbio.com/images/KAP1-[p-Ser824]-Antibody-Immunocytochemistry-Immunofluorescence-NB100-2350-img0015.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for PFDN5 Antibody (NBP2-94869)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PFDN5 |
![Immunocytochemistry/Immunofluorescence: PFDN5 Antibody [NBP2-94869] - Immunofluorescence analysis of C6 cells using PFDN5 Rabbit pAb (NBP2-94869) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/PFDN5-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-94869-img0004.jpg "Immunocytochemistry/Immunofluorescence: PFDN5 Antibody [NBP2-94869] - Immunofluorescence analysis of C6 cells using PFDN5 Rabbit pAb (NBP2-94869) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: PFDN5 Antibody [NBP2-94869] - Analysis of HeLa cells using PFDN5 . Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/PFDN5-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-94869-img0001.jpg "Immunocytochemistry/Immunofluorescence: PFDN5 Antibody [NBP2-94869] - Analysis of HeLa cells using PFDN5 . Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: PFDN5 Antibody [NBP2-94869] - Analysis of L929 cells using PFDN5 . Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/PFDN5-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-94869-img0002.jpg "Immunocytochemistry/Immunofluorescence: PFDN5 Antibody [NBP2-94869] - Analysis of L929 cells using PFDN5 . Blue: DAPI for nuclear staining.")
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Immunocytochemistry EGR1 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2818_human-egr1-affinity-purified-polyclonal-ab-immunocytochemistry-3102024831..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")