Home » PER3 » PER3 Antibodies » PER3 Antibody
Novus Biologicals products are now on bio-techne.com

PER3 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: PER3 Antibody [NBP3-10332] - Western blot analysis of PER3 in HepG2 Whole cell lysates. Antibody dilution at 1.0ug/ml
Western Blot: PER3 Antibody [NBP3-10332] - Western blot analysis of PER3 in HepG2 Whole cell lysates. Antibody dilution at 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
0.5 mg/ml

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

PER3 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human PER3. Peptide sequence DATLFCEPWTLNMQPAPLTSEEFKHVGLTAAVLSAHTQKEEQNYVDKFRE
Clonality
Polyclonal
Host
Rabbit
Gene
PER3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
133 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Concentration
0.5 mg/ml
Purity
Affinity purified

Alternate Names for PER3 Antibody

  • Cell growth-inhibiting gene 13 protein
  • Circadian clock protein PERIOD 3
  • GIG13
  • growth-inhibiting protein 13
  • hPER3
  • period (Drosophila) homolog 3
  • period 3
  • period circadian protein 3
  • period circadian protein homolog 3
  • period homolog 3 (Drosophila)

Background

PER3 is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. Circadian expression in the suprachiasmatic nucleus continues in constant darkness, and a shift in the light/dark cycle evokes a proportional shift of gene expression in the suprachiasmatic nucleus. The specific function of this gene is not yet known. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PER2 Antibody -
BSA Free
NB100-125
Western Blot PER2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PER2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence PER2 Antibody - BSA Free
(3 Reviews)
(11 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
PER1 Antibody
NBP2-24589
Immunohistochemistry-Paraffin PER1 Antibody
Western Blot PER1 Antibody
(1 Review)
(4 Publications)
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: IB, IHC, IHC-P, KO, WB
PGAP3 Antibody
NBP3-12196
Immunohistochemistry-Paraffin PGAP3 Antibody
Species: Hu, Mu, Rt
Applications: DB, ELISA, IHC, IHC-P, IP, WB
BMAL1 Antibody
NB100-2288
Flow (Intracellular) BMAL1 Antibody
Immunohistochemistry BMAL1 Antibody
Flow Cytometry BMAL1 Antibody
(1 Review)
(70 Publications)
Species: Am, Hu, Mu, Pm, Rt
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
CRY2 Antibody
(OTI1H5)
NBP2-00749
Flow Cytometry CRY2 Antibody (OTI1H5)
Flow Cytometry CRY2 Antibody (OTI1H5)
Immunohistochemistry-Paraffin CRY2 Antibody (OTI1H5)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
CRY1 Antibody
[Unconjugated]
AF3764
Immunocytochemistry CRY1 Antibody [Unconjugated]
(1 Publication)
Species: Hu, Mu
Applications: ICC, IHC, WB
CLOCK Antibody
NB100-126
Western Blot CLOCK Antibody
(4 Publications)
Species: Hu, Mu
Applications: ChIP, WB
LIGHT/TNFSF14
[Unconjugated]
664-LI
SDS-PAGE LIGHT/TNFSF14 [Unconjugated]
Bioactivity LIGHT/TNFSF14 [Unconjugated]
(21 Publications)
Species: Hu
Applications: BA
Vitamin D BP
Antibody
NBP1-88027
Western Blot Vitamin D BP Antibody
Western Blot Vitamin D BP Antibody
Western Blot Vitamin D BP Antibody
(2 Reviews)
Species: Eq, Hu, Mu, Rt
Applications: IHC, IHC-P, Simple Western, WB
HSD17B4 Antibody
NBP1-85296
Immunohistochemistry-Paraffin HSD17B4 Antibody
Immunohistochemistry-Paraffin HSD17B4 Antibody
Immunohistochemistry-Paraffin HSD17B4 Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
D Box Binding
Protein Antibody
NBP2-83997
Immunohistochemistry D Box Binding Protein Antibody
Western Blot D Box Binding Protein Antibody
Western Blot D Box Binding Protein Antibody
Species: Hu
Applications: IHC, IHC-P, WB
Timeless Antibody
NB100-40853
Western Blot Timeless Antibody
Immunohistochemistry-Paraffin Timeless Antibody
Western Blot Timeless Antibody
(1 Review)
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Exosome component
10 Antibody
NBP1-32870
Western Blot Exosome component 10 Antibody
Immunohistochemistry-Paraffin Exosome component 10 Antibody
Western Blot Exosome component 10 Antibody
(2 Reviews)
(3 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, KD, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(807 Publications)
Species: Hu
Applications: BA
PER3 Antibody
NBP3-10332
PER3 Antibody
Species: Hu
Applications: WB

Publications for PER3 Antibody (NBP3-10332) (0)

There are no publications for PER3 Antibody (NBP3-10332).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PER3 Antibody (NBP3-10332) (0)

There are no reviews for PER3 Antibody (NBP3-10332). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PER3 Antibody (NBP3-10332) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PER3 Products

Array NBP3-10332

Research Areas for PER3 Antibody (NBP3-10332)

Find related products by research area.

Blogs on PER3

There are no specific blogs for PER3, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PER3 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PER3