Novus Biologicals products are now on bio-techne.com

Recombinant Human PDCD10 GST (N-Term) Protein

Name: Recombinant Human PDCD10 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00011235-Q01
Price: 569 USD

Submit a Review

Images

(

Enlarge)

12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	WB, ELISA, MA, AP

Order Details

100% Guarantee on every product

Recombinant Human PDCD10 GST (N-Term) Protein Summary

Description	A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 103-212 of Human PDCD10 Source: Wheat Germ (in vitro) Amino Acid Sequence: LNEKARALKQILSKIPDEINDRVRFLQTIKDIASAIKELLDTVNNVFKKYQYQNRRALEHQKKEFVKYSKSFSDTLKTYFKDGKAINVFVSANRLIHQTNLILQTFKTVA
Preparation Method	in vitro wheat germ expression system
Details of Functionality	This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source	Wheat germ
Protein/Peptide Type	Partial Recombinant Protein
Gene	PDCD10
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	ELISA Immunoaffinity Purification Protein Array Western Blot
Theoretical MW	37.84 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -80C. Avoid freeze-thaw cycles.
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human PDCD10 GST (N-Term) Protein

apoptosis-related protein 15
cerebral cavernous malformations 3
MGC1212
MGC24477
programmed cell death 10
programmed cell death protein 10
TF-1 cell apoptosis-related protein 15
TFAR15CCM3Cerebral cavernous malformations 3 protein

Background

PDCD10 - programmed cell death 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

KRIT1 Antibody

NBP2-47405

Immunohistochemistry-Paraffin KRIT1 Antibody

Species: Hu

Applications: IHC, IHC-P

CCM2 Antibody
(OTI1E9)

NBP2-01134

Immunohistochemistry-Paraffin CCM2 Antibody (OTI1E9)

Species: Hu, Mu, Rt

Applications: IHC, IHC-P, WB

STK25 Antibody
(1G6)

H00010494-M01

(3 Publications)

Species: Hu

Applications: ELISA, IHC, IHC-P, IP, S-ELISA, WB

MST4 Antibody (7H4)

H00051765-M02

Species: Hu, Rt

Applications: ELISA, ICC/IF, S-ELISA, WB

MST3 Antibody

NBP1-87833

Immunocytochemistry/ Immunofluorescence MST3 Antibody

Immunohistochemistry-Paraffin MST3 Antibody

(1 Review)

(2 Publications)

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, IHC, IHC-P, WB

Oncostatin M/OSM
[Unconjugated]

8475-OM/CF

(1 Publication)

Species: Hu

Applications: BA

ERK2 Antibody
[Unconjugated]

AF1230

Immunohistochemistry ERK2 Antibody [Unconjugated]

Knockout Validated ERK2 Antibody [Unconjugated]

(3 Publications)

Species: Hu, Mu, Rt

Applications: IHC, KO, WB

Rap1A/B Antibody
[Unconjugated]

AF3767

Immunohistochemistry Rap1A/B Antibody [Unconjugated]

(4 Publications)

Species: Hu, Mu, Rt

Applications: IHC, WB

Striatin Antibody

NB110-74571

(6 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IP, WB

SLK Antibody

NBP1-83024

Immunohistochemistry-Paraffin SLK Antibody

Species: Hu

Applications: ICC/IF, IHC, IHC-P

PTPN13/PTPL1
Antibody

NB100-56139

(1 Review)

(5 Publications)

Species: Hu

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

FoxC2 Antibody

AF6989

(26 Publications)

Species: Mu

Applications: IHC

AKT [p Ser473]
Antibody [Unconjugate ...

AF887

Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific

Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific

(49 Publications)

Species: Hu, Mu, Rt

Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB

Paxillin Antibody
[Unconjugated]

AF4259

Western Blot Paxillin Antibody [Unconjugated]

Simple Western Paxillin Antibody [Unconjugated]

(7 Publications)

Species: Hu, Mu, Rt

Applications: ICC, Simple Western, WB

JIK Antibody

NB300-815

(1 Publication)

Species: Hu

Applications: IHC, IHC-P, PEP-ELISA, WB

Rhodopsin Antibody
(4D2)

NBP2-59690

Immunohistochemistry Rhodopsin Antibody (4D2)

(1 Review)

(6 Publications)

Species: Am, Av, Fi, Ma, Ze

Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB

VEGFR2/KDR/Flk-1
Antibody [Unconjugate ...

AF644

Immunohistochemistry VEGFR2/KDR/Flk-1 Antibody [Unconjugated]

(3 Reviews)

(97 Publications)

Species: Mu

Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Neut, WB

RhoD Antibody

NBP1-58359

Species: Hu

Applications: IHC, IHC-P, WB

GRAP2 Antibody
(OTI1G2)

NBP2-00764

Species: Hu, Mu, Rt

Applications: Flow, IHC, IHC-P, WB

AIMP2 Antibody

NBP1-81575

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

Publications for PDCD10 Partial Recombinant Protein (H00011235-Q01) (0)

There are no publications for PDCD10 Partial Recombinant Protein (H00011235-Q01).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PDCD10 Partial Recombinant Protein (H00011235-Q01) (0)

There are no reviews for PDCD10 Partial Recombinant Protein (H00011235-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PDCD10 Partial Recombinant Protein (H00011235-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PDCD10 Products

Research Areas for PDCD10 Partial Recombinant Protein (H00011235-Q01)

Find related products by research area.

Blogs on PDCD10

There are no specific blogs for PDCD10, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Recombinant Mouse VEGFR2/KDR/Flk‑1 Fc Chimera (Catalog # 443-KD) inhibits Recombinant Mouse VEGF164 (Catalog # 493-MV) induced proliferation in HUVEC human umbilical vein endothelial cells in a dose-dependent manner (orange line). Inhibition of Recombinant Mouse VEGF164 (5 ng/mL) activity elicited by Recombinant Mouse VEGFR2/KDR/Flk‑1 Fc Chimera (50 ng/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Mouse VEGFR2/KDR/Flk‑1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF644). The ND50 is typically 0.1‑0.3 µg/mL.

VEGFR2/KDR/Flk-1 Antibody [Unconjugated]
AF644

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our Recombinant Human PDCD10 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol

PDCD10

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Recombinant Human PDCD10 GST (N-Term) Protein

Species Glossary

Images

Product Details

Order Details

Recombinant Human PDCD10 GST (N-Term) Protein Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for Recombinant Human PDCD10 GST (N-Term) Protein

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for PDCD10 Partial Recombinant Protein (H00011235-Q01) (0)

Reviews for PDCD10 Partial Recombinant Protein (H00011235-Q01) (0)

Product General Protocols

Video Protocols

FAQs for PDCD10 Partial Recombinant Protein (H00011235-Q01) (0)

Additional PDCD10 Products

Research Areas for PDCD10 Partial Recombinant Protein (H00011235-Q01)

Blogs on PDCD10

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics