![Western Blot: PD-ECGF/Thymidine Phosphorylase Antibody [NBP1-84916] - Analysis in human cell line CAPAN-2.](http://images.novusbio.com/fullsize/PD-ECGF-Thymidine-Phosphorylase-Antibody-Western-Blot-NBP1-84916-img0006.jpg "Western Blot: PD-ECGF/Thymidine Phosphorylase Antibody [NBP1-84916] - Analysis in human cell line CAPAN-2.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: EGSQGLPDPSPEPKQLPELIRMKRDGGRLSEADIRGFVAAVVNGSAQGAQIGAMLMAIRLRGMDLEETSVLTQALAQSGQQLEWPEAWRQQLVDKHSTGGVGDKVSLVLAPALAACGCKVPMISG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TYMP |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC reported in scientific literature (PMID: 26623038). For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Theoretical MW | 50 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
![Simple Western CLEC3B/Tetranectin Antibody (805035) [Unconjugated]](https://images.novusbio.com/images2/CLEC3B_MAB5170_Simple_Western_17560.jpg)
![Western Blot CLEC3B/Tetranectin Antibody (805035) [Unconjugated]](https://images.novusbio.com/images2/CLEC3B_MAB5170_Western_Blot_12710.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for PD-ECGF/Thymidine Phosphorylase Antibody (NBP1-84916)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: PD-ECGF/Thymidine Phosphorylase Antibody [NBP1-84916] - Staining in human lymph node and skeletal muscle tissues . Corresponding TYMP RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/PD-ECGF-Thymidine-Phosphorylase-Antibody-Immunohistochemistry-Paraffin-NBP1-84916-img0013.jpg "Immunohistochemistry-Paraffin: PD-ECGF/Thymidine Phosphorylase Antibody [NBP1-84916] - Staining in human lymph node and skeletal muscle tissues . Corresponding TYMP RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: PD-ECGF/Thymidine Phosphorylase Antibody [NBP1-84916] - Staining of human lymph node shows moderate cytoplasmic positivity in lymphoid cells.](http://images.novusbio.com/fullsize/PD-ECGF-Thymidine-Phosphorylase-Antibody-Immunohistochemistry-Paraffin-NBP1-84916-img0007.jpg "Immunohistochemistry-Paraffin: PD-ECGF/Thymidine Phosphorylase Antibody [NBP1-84916] - Staining of human lymph node shows moderate cytoplasmic positivity in lymphoid cells.")
![Immunohistochemistry-Paraffin: PD-ECGF/Thymidine Phosphorylase Antibody [NBP1-84916] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.](http://images.novusbio.com/fullsize/PD-ECGF-Thymidine-Phosphorylase-Antibody-Immunohistochemistry-Paraffin-NBP1-84916-img0008.jpg "Immunohistochemistry-Paraffin: PD-ECGF/Thymidine Phosphorylase Antibody [NBP1-84916] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.")
![Immunohistochemistry-Paraffin: PD-ECGF/Thymidine Phosphorylase Antibody [NBP1-84916] - Staining of human small intestine shows moderate cytoplasmic positivity in lymphoid cells.](http://images.novusbio.com/fullsize/PD-ECGF-Thymidine-Phosphorylase-Antibody-Immunohistochemistry-Paraffin-NBP1-84916-img0009.jpg "Immunohistochemistry-Paraffin: PD-ECGF/Thymidine Phosphorylase Antibody [NBP1-84916] - Staining of human small intestine shows moderate cytoplasmic positivity in lymphoid cells.")
![Immunohistochemistry-Paraffin: PD-ECGF/Thymidine Phosphorylase Antibody [NBP1-84916] - Staining of human skeletal muscle shows no positivity in myocytes as expected.](http://images.novusbio.com/fullsize/PD-ECGF-Thymidine-Phosphorylase-Antibody-Immunohistochemistry-Paraffin-NBP1-84916-img0010.jpg "Immunohistochemistry-Paraffin: PD-ECGF/Thymidine Phosphorylase Antibody [NBP1-84916] - Staining of human skeletal muscle shows no positivity in myocytes as expected.")
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunohistochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunohistochemistry_6728.jpg)
![Immunocytochemistry CD55/DAF Antibody [Unconjugated]](https://images.novusbio.com/images2/CD55_AF2009_Immunocytochemistry__Immunofluorescence_23052.jpg)
![Immunohistochemistry Complement Factor H Antibody [Unconjugated]](https://images.novusbio.com/images2/Complement_Factor_H_AF4779_Immunohistochemistry_7182.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")