![Western Blot: PCYT1A Antibody (6E6) [H00005130-M02] - PCYT1A monoclonal antibody (M02), clone 6E6. Analysis of PCYT1A expression in K-562.](http://images.novusbio.com/fullsize/PCYT1A-Antibody-6E6-Western-Blot-H00005130-M02-img0008.jpg "Western Blot: PCYT1A Antibody (6E6) [H00005130-M02] - PCYT1A monoclonal antibody (M02), clone 6E6. Analysis of PCYT1A expression in K-562.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF |
| Clone | 6E6 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | PCYT1A (NP_005008, 2 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRGTPCERPVRVYADGIFDLFHS |
| Specificity | PCYT1A - phosphate cytidylyltransferase 1, choline, alpha (6E6) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | PCYT1A |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Immunohistochemistry PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Immunohistochemistry_16650.jpg)
![Western Blot PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Western_Blot_16656.jpg)
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for PCYT1A Antibody (H00005130-M02)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: PCYT1A Antibody (6E6) [H00005130-M02] - Analysis of monoclonal antibody to PCYT1A on HeLa cell . Antibody concentration 20 ug/ml.](http://images.novusbio.com/fullsize/PCYT1A-Antibody-6E6-Immunocytochemistry-Immunofluorescence-H00005130-M02-img0005.jpg "Immunocytochemistry/Immunofluorescence: PCYT1A Antibody (6E6) [H00005130-M02] - Analysis of monoclonal antibody to PCYT1A on HeLa cell . Antibody concentration 20 ug/ml.")
![Western Blot: PCYT1A Antibody (6E6) [H00005130-M02] - PCYT1A monoclonal antibody (M02), clone 6E6. Analysis of PCYT1A expression in PC-12.](http://images.novusbio.com/fullsize/PCYT1A-Antibody-6E6-Western-Blot-H00005130-M02-img0007.jpg "Western Blot: PCYT1A Antibody (6E6) [H00005130-M02] - PCYT1A monoclonal antibody (M02), clone 6E6. Analysis of PCYT1A expression in PC-12.")
![ELISA: PCYT1A Antibody (6E6) [H00005130-M02] - PCYT1A Antibody (6E6) [H00005130-M02] - Detection limit for recombinant GST tagged PCYT1A is approximately 3ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/PCYT1A-Antibody-6E6-ELISA-H00005130-M02-img0009.jpg "ELISA: PCYT1A Antibody (6E6) [H00005130-M02] - PCYT1A Antibody (6E6) [H00005130-M02] - Detection limit for recombinant GST tagged PCYT1A is approximately 3ng/ml as a capture antibody.")
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
