Novus Biologicals products are now on bio-techne.com

PCTAIRE1 Antibody (2E5)

Name: PCTAIRE1 Antibody (2E5)
Brand: Novus Biologicals
SKU: H00005127-M02
Price: 499 USD

Submit a Review

Images

(

Enlarge)

Western Blot: PCTAIRE1 Antibody (2E5) [H00005127-M02] - Analysis of PCTK1 expression in transfected 293T cell line by PCTK1 monoclonal antibody (M02), clone 2E5.Lane 1: PCTK1 transfected lysate (Predicted MW: 55.7 ...read more

Immunocytochemistry/ Immunofluorescence: PCTAIRE1 Antibody (2E5) [H00005127-M02] - Analysis of monoclonal antibody to PCTK1 on HeLa cell . Antibody concentration 10 ug/ml.

Western Blot: PCTAIRE1 Antibody (2E5) [H00005127-M02] - PCTK1 monoclonal antibody (M02), clone 2E5 Western Blot analysis of PCTK1 expression in Hela NE ( Cat # L013V3 ).

Immunoprecipitation: PCTAIRE1 Antibody (2E5) [H00005127-M02] - Analysis of PCTK1 transfected lysate using anti-PCTK1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with PCTK1 MaxPab rabbit polyclonal ...read more

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	WB, ELISA, ICC/IF, IP
Clone	2E5
Clonality	Monoclonal
Host	Mouse
Conjugate	Unconjugated

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

PCTAIRE1 Antibody (2E5) Summary

Description	Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen	PCTK1 (AAH01048, 1 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MDRMKKIKRQLSMTLRGGRGIDKTNGAPEQIGLDESGGGGGSDPGEAPTRAAPGELRSARGPLSSAPEIVHEDLKMGSDG
Specificity	PCTK1 (2E5)
Isotype	IgG2a Kappa
Clonality	Monoclonal
Host	Mouse
Gene	CDK16
Purity	IgG purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Applications/Dilutions

Dilutions	ELISA Immunocytochemistry/ Immunofluorescence Immunoprecipitation Western Blot 1:500
Application Notes	Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage	Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer	In 1x PBS, pH 7.4
Preservative	No Preservative
Purity	IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for PCTAIRE1 Antibody (2E5)

CDK16
Cell division protein kinase 16
cyclin-dependent kinase 16
EC 2.7.11
EC 2.7.11.22
FLJ16665
PCTAIRE protein kinase 1
PCTAIRE
PCTAIRE1
PCTAIRE-motif protein kinase 1
PCTGAIRE
PCTK1
PCTK1Serine/threonine-protein kinase PCTAIRE-1

Background

The protein encoded by this gene belongs to the cdc2/cdkx subfamily of the ser/thr family of protein kinases. It may play a role in signal transduction cascades in terminally differentiated cells. This gene is thought to escape X inactivation. Two transcript variants encoding the same protein have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

CCNY Antibody

NBP1-88542

Immunohistochemistry-Paraffin CCNY Antibody

(1 Publication)

Species: Hu

Applications: IHC, IHC-P, WB

Cdk5 Antibody

NBP2-15843

Immunohistochemistry-Paraffin Cdk5 Antibody

Immunocytochemistry/ Immunofluorescence Cdk5 Antibody

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, KO, WB

USP11 Antibody

NBP1-80640

(2 Publications)

Species: Hu

Applications: ICC/IF, IHC, IHC-P

CDK5 Activator 1
Antibody

NBP3-13279

Immunohistochemistry-Paraffin CDK5 Activator 1 Antibody

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

CDCA5 Antibody

NBP1-89530

Immunohistochemistry-Paraffin CDCA5 Antibody

Immunocytochemistry/ Immunofluorescence CDCA5 Antibody

(1 Publication)

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

Ficolin-2
[Unconjugated]

2428-FC

(2 Publications)

Species: Hu

Applications: Bind

Mkl1 Antibody

NBP1-88498

(9 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P, KD, WB

Annexin A1
Antibody [Unconjugate

AF3770

Immunohistochemistry Annexin A1 Antibody [Unconjugated]

Simple Western Annexin A1 Antibody [Unconjugated]

(1 Review)

(6 Publications)

Species: Hu, Mu, Rt

Applications: IHC, Simple Western, WB

MKL2 Antibody

NBP1-46209

(4 Publications)

Species: Hu, Pm, Mu

Applications: IB, ICC/IF, IHC, IHC-P, IP, WB

Ubiquitin-activating E ...

E-305

(138 Publications)

Species: Hu

Applications: EnzAct

Uroplakin IIIB
Antibody

NBP1-92564

(1 Review)

Species: Hu

Applications: ICC/IF, IHC, IHC-P

Serum Response
Factor SRF Antibody ( ...

NBP3-13785

Immunocytochemistry/ Immunofluorescence Serum Response Factor SRF Antibody (PCRP-SRF-1F7)

Immunohistochemistry-Paraffin Serum Response Factor SRF Antibody (PCRP-SRF-1F7)

Species: Hu

Applications: ELISA, Flow, ICC/IF, IHC-P, IP, PA, WB

GCHFR Antibody
(846011) [Unconjugate

MAB7918

Western Blot GCHFR Antibody (846011) [Unconjugated]

Species: Hu

Applications: Simple Western, WB

CDC2/CDK1 Antibody

NBP1-85729

(6 Publications)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

IL-12
[Unconjugated]

419-ML

(273 Publications)

Species: Mu

Applications: BA

PFTK1 Antibody

NBP1-80920

Immunohistochemistry-Paraffin PFTK1 Antibody

(1 Publication)

Species: Hu

Applications: ICC/IF, IHC, IHC-P

NSF Antibody

NBP1-87035

Immunohistochemistry-Paraffin NSF Antibody

(1 Publication)

Species: Hu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

DNA Polymerase
delta, catalytic subu ...

NBP2-33466

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

Publications for PCTAIRE1 Antibody (H00005127-M02) (0)

There are no publications for PCTAIRE1 Antibody (H00005127-M02).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PCTAIRE1 Antibody (H00005127-M02) (0)

There are no reviews for PCTAIRE1 Antibody (H00005127-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

ICC/IF Video Protocol

FAQs for PCTAIRE1 Antibody (H00005127-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

Isotype Controls

Additional PCTAIRE1 Products

Research Areas for PCTAIRE1 Antibody (H00005127-M02)

Find related products by research area.

Cell Cycle and Replication

Blogs on PCTAIRE1

There are no specific blogs for PCTAIRE1, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western blot shows detection of Mouse Anti-Human/Mouse/Rat STAT3 Monoclonal Antibody (MAB1799) using a 1:1000 dilution of HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.

Goat anti-Mouse IgG Secondary Antibody [HRP]
HAF007

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Review this Product

Be the first to review our PCTAIRE1 Antibody (2E5) and receive a gift card or discount.

Bioinformatics

Gene Symbol	CDK16
Entrez	5127(Human)
OMIM	311550(Human)
Uniprot	AAH01048(Human)

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

PCTAIRE1 Antibody (2E5)

Species Glossary

Images

Product Details

Order Details

PCTAIRE1 Antibody (2E5) Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for PCTAIRE1 Antibody (2E5)

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for PCTAIRE1 Antibody (H00005127-M02) (0)

Reviews for PCTAIRE1 Antibody (H00005127-M02) (0)

Product General Protocols

Video Protocols

FAQs for PCTAIRE1 Antibody (H00005127-M02) (0)

Secondary Antibodies

Isotype Controls

Additional PCTAIRE1 Products

Research Areas for PCTAIRE1 Antibody (H00005127-M02)

Blogs on PCTAIRE1

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics