![Immunohistochemistry-Paraffin: PCSK1N Antibody [NBP1-80797] - Staining in human cerebral cortex and tonsil tissues using anti-PCSK1N antibody. Corresponding PCSK1N RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/PCSK1N-Antibody-Immunohistochemistry-Paraffin-NBP1-80797-img0005.jpg "Immunohistochemistry-Paraffin: PCSK1N Antibody [NBP1-80797] - Staining in human cerebral cortex and tonsil tissues using anti-PCSK1N antibody. Corresponding PCSK1N RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: AETGAPRRFRRSVPRGEAAGAVQELARALAHLLEAERQERARAEAQEAEDQQARVLAQLLRVWGAPRNSDPALGLDDDPDAPAAQLARALLRARLDPAALAAQLVP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PCSK1N |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: PCSK1N Antibody [NBP1-80797] - Staining of human adrenal gland, kidney, liver and pituitary gland using Anti-PCSK1N antibody NBP1-80797 (A) shows similar protein distribution across tissues to independent antibody NBP2-49423 (B).](http://images.novusbio.com/fullsize/PCSK1N-Antibody-Immunohistochemistry-Paraffin-NBP1-80797-img0006.jpg "Immunohistochemistry-Paraffin: PCSK1N Antibody [NBP1-80797] - Staining of human adrenal gland, kidney, liver and pituitary gland using Anti-PCSK1N antibody NBP1-80797 (A) shows similar protein distribution across tissues to independent antibody NBP2-49423 (B).")
![Immunohistochemistry-Paraffin: PCSK1N Antibody [NBP1-80797] - Staining of human kidney.](http://images.novusbio.com/fullsize/PCSK1N-Antibody-Immunohistochemistry-Paraffin-NBP1-80797-img0010.jpg "Immunohistochemistry-Paraffin: PCSK1N Antibody [NBP1-80797] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: PCSK1N Antibody [NBP1-80797] - Staining of human cerebral cortex shows high expression.](http://images.novusbio.com/fullsize/PCSK1N-Antibody-Immunohistochemistry-Paraffin-NBP1-80797-img0003.jpg "Immunohistochemistry-Paraffin: PCSK1N Antibody [NBP1-80797] - Staining of human cerebral cortex shows high expression.")
![Immunohistochemistry-Paraffin: PCSK1N Antibody [NBP1-80797] - Staining of human tonsil shows low expression as expected.](http://images.novusbio.com/fullsize/PCSK1N-Antibody-Immunohistochemistry-Paraffin-NBP1-80797-img0004.jpg "Immunohistochemistry-Paraffin: PCSK1N Antibody [NBP1-80797] - Staining of human tonsil shows low expression as expected.")
![Immunohistochemistry-Paraffin: PCSK1N Antibody [NBP1-80797] - Staining of human adrenal gland.](http://images.novusbio.com/fullsize/PCSK1N-Antibody-Immunohistochemistry-Paraffin-NBP1-80797-img0007.jpg "Immunohistochemistry-Paraffin: PCSK1N Antibody [NBP1-80797] - Staining of human adrenal gland.")
![Immunohistochemistry-Paraffin: PCSK1N Antibody [NBP1-80797] - Staining of human pituitary gland.](http://images.novusbio.com/fullsize/PCSK1N-Antibody-Immunohistochemistry-Paraffin-NBP1-80797-img0008.jpg "Immunohistochemistry-Paraffin: PCSK1N Antibody [NBP1-80797] - Staining of human pituitary gland.")
![Immunohistochemistry-Paraffin: PCSK1N Antibody [NBP1-80797] - Staining of human liver.](http://images.novusbio.com/fullsize/PCSK1N-Antibody-Immunohistochemistry-Paraffin-NBP1-80797-img0009.jpg "Immunohistochemistry-Paraffin: PCSK1N Antibody [NBP1-80797] - Staining of human liver.")
![Intracellular Staining by Flow Cytometry Carboxypeptidase E/CPE Antibody [Unconjugated]](https://images.novusbio.com/images2/Carboxypeptidase_E_AF3587_Flow_Cytometry_3467.jpg)
![Immunocytochemistry Carboxypeptidase E/CPE Antibody [Unconjugated]](https://images.novusbio.com/images2/Carboxypeptidase_E_AF3587_Immunocytochemistry_12010.jpg)
![Immunohistochemistry Carboxypeptidase E/CPE Antibody [Unconjugated]](https://images.novusbio.com/images2/Carboxypeptidase_E_AF3587_Immunohistochemistry_12592.jpg)
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")