Home » Pax7 » Pax7 Proteins » Recombinant Human Pax7 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human Pax7 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
SDS-Page: Pax7 Partial Protein [H00005081-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
SDS-Page: Pax7 Partial Protein [H00005081-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human Pax7 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 411-520 of Human Pax7

Source: Wheat Germ (in vitro)

Amino Acid Sequence: GGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTTGYSVDPVAGYQYGQYGQSECLVPWASPVPIPSPTPRASCLFMESYKVVSGWGMSISQMEKLKSSQMEQFT
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
PAX7
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Pax7 GST (N-Term) Protein

  • FLJ37460
  • HUP1
  • paired box 7
  • paired box gene 7
  • paired box homeotic gene 7
  • paired box protein Pax-7
  • paired domain gene 7
  • PAX7 transcriptional factor
  • Pax7
  • PAX7B
  • RMS2

Background

PAX7 is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box 7 gene is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Alternative splicing in this gene has produced two known products but the biological significance of the variants is unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Pax3/Pax7 Antibody
(274212) [Unconjugate ...
MAB2457
Immunocytochemistry Pax3/Pax7 Antibody (274212) [Unconjugated]
Immunocytochemistry/ Immunofluorescence Pax3/Pax7 Antibody (274212) [Unconjugated]
(1 Review)
(19 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, WB
MyoD Antibody
(5.8A) - BSA Free
NB100-56511
Immunocytochemistry/ Immunofluorescence MyoD Antibody (5.8A) - BSA Free
Immunocytochemistry/ Immunofluorescence MyoD Antibody (5.8A) - BSA Free
Western Blot MyoD Antibody (5.8A) - BSA Free
(2 Reviews)
(27 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
Myogenin Antibody
(671037)
MAB66861
Western Blot Myogenin Antibody (671037)
Immunocytochemistry Myogenin Antibody (671037)
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, WB
FoxO1/FKHR
Antibody (83N7F8) - B
NBP2-31376
Flow Cytometry FoxO1/FKHR Antibody (83N7F8) - BSA Free
Flow Cytometry FoxO1/FKHR Antibody (83N7F8) - BSA Free
Flow Cytometry FoxO1/FKHR Antibody (83N7F8) - BSA Free
(1 Review)
(7 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
MYF-5 Antibody
(OTI2G5)
NBP2-44245
Western Blot MYF-5 Antibody (OTI2G5)
Immunohistochemistry-Paraffin MYF-5 Antibody (OTI2G5)
Immunohistochemistry-Paraffin MYF-5 Antibody (OTI2G5)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Sonic Hedgehog/Shh
[Unconjugated]
464-SH
Bioactivity Sonic Hedgehog/Shh [Unconjugated]
SDS-PAGE Sonic Hedgehog/Shh [Unconjugated]
SEC-MALS Sonic Hedgehog/Shh [Unconjugated]
(69 Publications)
Species: Mu
Applications: BA
Desmin Antibody
[Unconjugated]
AF3844
Immunohistochemistry Desmin Antibody [Unconjugated]
Immunohistochemistry Desmin Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence Desmin Antibody [Unconjugated]
(2 Reviews)
(34 Publications)
Species: Hu, Mu
Applications: IHC
SS18L1 Antibody
NBP2-20486
Immunoprecipitation SS18L1 Antibody
Immunohistochemistry-Paraffin SS18L1 Antibody
Immunocytochemistry/ Immunofluorescence SS18L1 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Pax6 Antibody
[Unconjugated]
AF8150
Simple Western Pax6 Antibody [Unconjugated]
Immunocytochemistry Pax6 Antibody [Unconjugated]
Western Blot Pax6 Antibody [Unconjugated]
(16 Publications)
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
ERMAP Antibody
[Unconjugated]
AF4928
Flow Cytometry ERMAP Antibody [Unconjugated]
Species: Hu
Applications: CyTOF-ready, Flow, WB
GDF-8/Myostatin
[Unconjugated]
788-G8/CF
SDS-PAGE GDF-8/Myostatin [Unconjugated]
Bioactivity GDF-8/Myostatin [Unconjugated]
(40 Publications)
Species: Hu, Mu, Rt
Applications: BA
Dystrophin Antibody
NBP1-89953
Immunohistochemistry-Paraffin Dystrophin Antibody
Immunohistochemistry-Paraffin Dystrophin Antibody
Immunohistochemistry-Paraffin Dystrophin Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
CD34 Antibody
[Unconjugated]
AF4117
Immunohistochemistry CD34 Antibody [Unconjugated]
(3 Reviews)
(37 Publications)
Species: Rt
Applications: IHC, WB
HGF [Unconjugated]
294-HG
Bioactivity HGF [Unconjugated]
Cell Culture HGF [Unconjugated]
(113 Publications)
Species: Hu
Applications: BA
KIDINS220 Antibody
NBP1-88995
Immunocytochemistry/ Immunofluorescence KIDINS220 Antibody
Western Blot KIDINS220 Antibody
Immunohistochemistry-Paraffin KIDINS220 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(665 Publications)
Species: Mu
Applications: ELISA
IGF-I/IGF-1
[Unconjugated]
291-G1
SDS-PAGE IGF-I/IGF-1 [Unconjugated]
Bioactivity IGF-I/IGF-1 [Unconjugated]
Mass Spectrometry IGF-I/IGF-1 [Unconjugated]
(224 Publications)
Species: Hu
Applications: BA
PCNA Antibody
(PC10)
NB500-106
Immunocytochemistry/ Immunofluorescence PCNA Antibody (PC10)
Western Blot PCNA Antibody (PC10)
Flow Cytometry PCNA Antibody (PC10)
(5 Reviews)
(46 Publications)
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
CD45 Antibody
[Unconjugated]
AF114
Immunohistochemistry CD45 Antibody [Unconjugated]
Immunocytochemistry CD45 Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence CD45 Antibody [Unconjugated]
(1 Review)
(70 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Recombinant Human
Pax7 GST (N-Term) Pro ...
H00005081-Q01
Recombinant Human Pax7 GST (N-Term) Protein
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP

Publications for Pax7 Partial Recombinant Protein (H00005081-Q01) (0)

There are no publications for Pax7 Partial Recombinant Protein (H00005081-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Pax7 Partial Recombinant Protein (H00005081-Q01) (0)

There are no reviews for Pax7 Partial Recombinant Protein (H00005081-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Pax7 Partial Recombinant Protein (H00005081-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Pax7 Products

Research Areas for Pax7 Partial Recombinant Protein (H00005081-Q01)

Find related products by research area.

Blogs on Pax7

There are no specific blogs for Pax7, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Pax7 was detected in immersion fixed C2C12 mouse myoblast cell line using 10 µg/mL Mouse Anti-Human/Mouse/Rat/Chicken Pax7 Monoclonal Antibody (Catalog # MAB1675) for 3 hours at room temperature. Cells were stained (red). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Pax7 Antibody (PAX7) [Unconjugated]
MAB1675

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Pax7 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol PAX7