Novus Biologicals products are now on bio-techne.com

PAIP1 Recombinant Protein Antigen

Name: PAIP1 Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP2-68963PEP
Price: 289 USD

Images

There are currently no images for PAIP1 Recombinant Protein Antigen (NBP2-68963PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals offers 100% Guarantee

PAIP1 Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PAIP1. Source: E. coli Amino Acid Sequence: GTNGQVTRADILQVGLRELLNALFSNPMDDNLICAVKLLKLTGSVLEDAWKEKGKMDMEEIIQRIENVVLDANCSRDVKQMLLK Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	PAIP1
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10-100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68963. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW	27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for PAIP1 Recombinant Protein Antigen

MGC12360
PABC1-interacting protein 1
PABP-interacting protein 1
PAIP-1
poly(A) binding protein interacting protein 1
Poly(A)-binding protein-interacting protein 1
polyadenylate binding protein-interacting protein 1
polyadenylate-binding protein-interacting protein 1

Background

PAIP1 is encoded by this gene interacts with poly(A)-binding protein and with the cap-binding complex eIF4A. It is involved in translational initiation and protein biosynthesis. Overexpression of this gene in COS7 cells stimulates translation. Alternative splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

PABP Antibody
(10E10) - BSA Free

NB120-6125

Western Blot PABP Antibody (10E10) - BSA Free

(1 Review)

(11 Publications)

Species: Bv, Ca, Dr(-), Hu, Mu(-), Pm, Xp

Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IP, MiAr, WB

eIF4G1 Antibody -
BSA Free

NB100-268

Immunoprecipitation eIF4G1 Antibody - BSA Free

(26 Publications)

Species: Hu, Po

Applications: IP, WB

PAIP2 Antibody -
BSA Free

NBP2-38802

Immunohistochemistry PAIP2 Antibody - BSA Free

Species: Hu

Applications: ICC/IF, IHC, IHC-P

eIF4E [p Ser209]
Antibody - BSA Free

NB100-81898

Immunocytochemistry/ Immunofluorescence eIF4E [p Ser209] Antibody - BSA Free

Immunohistochemistry-Paraffin eIF4E [p Ser209] Antibody - BSA Free

(1 Publication)

Species: Hu, Po

Applications: ICC/IF, IHC, IHC-P, WB

eIF4A2 Antibody

NBP2-24529

Immunohistochemistry-Paraffin eIF4A2 Antibody

(1 Review)

(1 Publication)

Species: Ca, Ch, Hu, Mu, Pm

Applications: IHC, IHC-P, Simple Western, WB

eIF4A1 Antibody

NBP2-24632

Immunohistochemistry-Paraffin eIF4A1 Antibody

(2 Publications)

Species: Ca, Ch, Hu, Mu, Pm, Rt

Applications: IHC, IHC-P, WB

UBR5/EDD Antibody
- BSA Free

NB100-1591

Western Blot UBR5/EDD Antibody - BSA Free

(10 Publications)

Species: Hu, Mu

Applications: IHC, IHC-P, IP, KD, WB

HSP27 Antibody
(G3.1)

NBP2-32972

Immunocytochemistry/ Immunofluorescence HSP27 Antibody (G3.1)

(1 Review)

(5 Publications)

Species: Ch, Pm, Hu, Pm, Mu, Rt, Sh

Applications: Flow, ICC/IF, IHC, IHC-P, WB

CSDE1 Antibody -
BSA Free

NBP1-85341

Species: Hu

Applications: ICC/IF, IHC, IHC-P, WB

SOD1/Cu-Zn SOD
Antibody - BSA Free

NBP2-24915

Immunohistochemistry-Paraffin SOD1/Cu-Zn SOD Antibody - BSA Free

(3 Reviews)

(21 Publications)

Species: Bv, Hu, Mu, Rt

Applications: IHC, IHC-P, WB

PAIP2B Antibody -
BSA Free

NBP2-30969

Species: Hu

Applications: IHC, IHC-P

Cathepsin H
Antibody [Unconjugate

AF1013

(5 Publications)

Species: Mu

Applications: IHC, IP, WB

eIF4GII Antibody

NBP2-16309

Immunohistochemistry-Frozen eIF4GII Antibody

(1 Review)

(1 Publication)

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Ataxin-2 Antibody
- BSA Free

NBP1-90063

Immunohistochemistry-Paraffin Ataxin-2 Antibody - BSA Free

(6 Publications)

Species: Hu, Mu

Applications: ICC/IF, IHC, IHC-P

PSMC6 Antibody
(2C4) - Azide and BSA ...

H00005706-M02

Immunocytochemistry/ Immunofluorescence PSMC6 Antibody (2C4) - Azide and BSA Free

Species: Hu, Mu, Rt

Applications: ELISA, ICC/IF, KD, WB

HSBP1 Antibody -
BSA Free

NBP2-84079

Species: Hu

Applications: WB

Serpin A3N
Antibody [Unconjugate

AF4709

(34 Publications)

Species: Mu

Applications: IP, WB

SLBP Antibody
(2C4-1C8) - Azide and ...

H00007884-M01

Immunocytochemistry/ Immunofluorescence SLBP Antibody (2C4-1C8) - Azide and BSA Free

(4 Publications)

Species: Hu, Mu

Applications: ELISA, ICC/IF, WB

hnRNP-Q Antibody
(1R0G5)

NBP3-16838

Species: Hu, Mu, Rt

Applications: ICC/IF, IHC, IHC-P, WB

PAIP1 Recombinant
Protein Antigen

NBP2-68963PEP

Species: Hu

Applications: AC

Publications for PAIP1 Recombinant Protein Antigen (NBP2-68963PEP) (0)

There are no publications for PAIP1 Recombinant Protein Antigen (NBP2-68963PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PAIP1 Recombinant Protein Antigen (NBP2-68963PEP) (0)

There are no reviews for PAIP1 Recombinant Protein Antigen (NBP2-68963PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for PAIP1 Recombinant Protein Antigen (NBP2-68963PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional PAIP1 Products

Blogs on PAIP1

There are no specific blogs for PAIP1, but you can read our latest blog posts.

Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western Blot: SOD1/Cu-Zn SOD Antibody [NBP2-24915] - Human ocular fluid. Antibody at 1:1000. Western blot image submitted by a verified customer review.

SOD1/Cu-Zn SOD Antibody - BSA Free
NBP2-24915

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our PAIP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

PAIP1

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

PAIP1 Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

PAIP1 Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for PAIP1 Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for PAIP1 Recombinant Protein Antigen (NBP2-68963PEP) (0)

Reviews for PAIP1 Recombinant Protein Antigen (NBP2-68963PEP) (0)

FAQs for PAIP1 Recombinant Protein Antigen (NBP2-68963PEP) (0)

Additional PAIP1 Products

Blogs on PAIP1

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics