![Western Blot: CSDE1 Antibody [NBP1-85341] - Analysis in human cell line MCF-7.](http://images.novusbio.com/fullsize/CSDE1-Antibody-Western-Blot-NBP1-85341-img0007.jpg "Western Blot: CSDE1 Antibody [NBP1-85341] - Analysis in human cell line MCF-7.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NLLHNNGHNGYPNGTSAALRETGVIEKLLTSYGFIQCSERQARLFFHCSQYNGNLQDLKVGDDVEFEVSSDRRTGKPIAVKLVKIKQEILPEERMNGQEVFYLTYTPEDVEGNVQLETGDKIN |
| Predicted Species | Mouse (97%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CSDE1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: PFA/Triton X-100 |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Immunohistochemistry_16650.jpg)
![Western Blot PTH Antibody (918462) [Unconjugated]](https://images.novusbio.com/images2/PTH_MAB7665_Western_Blot_16656.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CSDE1 |
![Immunocytochemistry/Immunofluorescence: CSDE1 Antibody [NBP1-85341] - Staining of human cell line A-431 shows positivity in cytoplasm.](http://images.novusbio.com/fullsize/CSDE1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85341-img0004.jpg "Immunocytochemistry/Immunofluorescence: CSDE1 Antibody [NBP1-85341] - Staining of human cell line A-431 shows positivity in cytoplasm.")
![Immunohistochemistry-Paraffin: CSDE1 Antibody [NBP1-85341] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/CSDE1-Antibody-Immunohistochemistry-Paraffin-NBP1-85341-img0016.jpg "Immunohistochemistry-Paraffin: CSDE1 Antibody [NBP1-85341] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: CSDE1 Antibody [NBP1-85341] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/CSDE1-Antibody-Immunohistochemistry-Paraffin-NBP1-85341-img0012.jpg "Immunohistochemistry-Paraffin: CSDE1 Antibody [NBP1-85341] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: CSDE1 Antibody [NBP1-85341] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/CSDE1-Antibody-Immunohistochemistry-Paraffin-NBP1-85341-img0013.jpg "Immunohistochemistry-Paraffin: CSDE1 Antibody [NBP1-85341] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: CSDE1 Antibody [NBP1-85341] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/CSDE1-Antibody-Immunohistochemistry-Paraffin-NBP1-85341-img0014.jpg "Immunohistochemistry-Paraffin: CSDE1 Antibody [NBP1-85341] - Staining of human endometrium shows moderate cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: CSDE1 Antibody [NBP1-85341] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/CSDE1-Antibody-Immunohistochemistry-Paraffin-NBP1-85341-img0015.jpg "Immunohistochemistry-Paraffin: CSDE1 Antibody [NBP1-85341] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Immunocytochemistry Integrin beta 2/CD18 Antibody [Unconjugated]](https://images.novusbio.com/images2/Integrin_beta_2_AF1730_Immunocytochemistry_6474.jpg)
![Immunocytochemistry Integrin beta 2/CD18 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af1730_human-integrin-beta-2-cd18-affinity-purified-polyclonal-ab-immunocytochemistry-1292023225343.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")