![Immunocytochemistry/Immunofluorescence: p400 Antibody [NBP1-88230] - Staining of human cell line U-2 OS shows localization to nucleus. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/p400-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88230-img0005.jpg "Immunocytochemistry/Immunofluorescence: p400 Antibody [NBP1-88230] - Staining of human cell line U-2 OS shows localization to nucleus. Antibody staining is shown in green.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DDEVDDEEETIEEEEANEGVVDHQTELSNLAKEAELPLLDLMKLYEGAFLPSSQWPRPKPDGEDTSGEEDADDCPGDRESRKDLVLIDSLFIMDQFKAAERMNIGKPNAKDIADVTAVAEAILPKGSARVTTSVKFNAPSL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | EP400 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-88230 | Applications | Species |
|---|---|---|
| Obri A, Ouararhni K, Papin C et al. ANP32E is a histone chaperone that removes H2A.Z from chromatin. Nature 2014-01-30 [PMID: 24463511] |
Secondary Antibodies |
Isotype Controls |
Research Areas for p400 Antibody (NBP1-88230)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | EP400 |
![Immunohistochemistry-Paraffin: p400 Antibody [NBP1-88230] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/p400-Antibody-Immunohistochemistry-Paraffin-NBP1-88230-img0010.jpg "Immunohistochemistry-Paraffin: p400 Antibody [NBP1-88230] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: p400 Antibody [NBP1-88230] - Analysis in human testis and liver tissues. Corresponding EP400 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/p400-Antibody-Immunohistochemistry-Paraffin-NBP1-88230-img0006.jpg "Immunohistochemistry-Paraffin: p400 Antibody [NBP1-88230] - Analysis in human testis and liver tissues. Corresponding EP400 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: p400 Antibody [NBP1-88230] - Staining of human cerebral cortex shows moderate nuclear positivity in neurons.](http://images.novusbio.com/fullsize/p400-Antibody-Immunohistochemistry-Paraffin-NBP1-88230-img0007.jpg "Immunohistochemistry-Paraffin: p400 Antibody [NBP1-88230] - Staining of human cerebral cortex shows moderate nuclear positivity in neurons.")
![Immunohistochemistry-Paraffin: p400 Antibody [NBP1-88230] - Staining of human liver shows no nuclear positivity in hepatocytes.](http://images.novusbio.com/fullsize/p400-Antibody-Immunohistochemistry-Paraffin-NBP1-88230-img0008.jpg "Immunohistochemistry-Paraffin: p400 Antibody [NBP1-88230] - Staining of human liver shows no nuclear positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: p400 Antibody [NBP1-88230] - Staining of human skin shows moderate nuclear positivity in smooth muscle cells.](http://images.novusbio.com/fullsize/p400-Antibody-Immunohistochemistry-Paraffin-NBP1-88230-img0009.jpg "Immunohistochemistry-Paraffin: p400 Antibody [NBP1-88230] - Staining of human skin shows moderate nuclear positivity in smooth muscle cells.")
![Western Blot CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/CBP_MAB2676_Western_Blot_6043.jpg)
![Immunocytochemistry CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/mab2676_human-mouse-rat-cbp-mab-clone-257003-immunocytochemistry-101220208237.jpg)
![Western Blot Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Western_Blot_5829.jpg)
![Immunocytochemistry Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Immunocytochemistry_11663.jpg)
![Immunocytochemistry Brg1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Brg1_AF5738_Immunocytochemistry_11664.jpg)
![Western Blot RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Western_Blot_10216.jpg)
![Immunocytochemistry RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Immunocytochemistry_10464.jpg)
![Simple Western RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Simple_Western_16629.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")