Home » p38 beta/MAPK11 » p38 beta/MAPK11 Proteins » p38 beta/MAPK11 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

p38 beta/MAPK11 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for p38 beta/MAPK11 Recombinant Protein Antigen (NBP2-48826PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

p38 beta/MAPK11 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human p38 beta/MAPK11.

Source: E. coli

Amino Acid Sequence: DYIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MAPK11
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-48826.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for p38 beta/MAPK11 Recombinant Protein Antigen

  • EC 2.7.11
  • EC 2.7.11.24
  • MAP kinase 11
  • MAP kinase p38 beta
  • MAPK 11
  • MAPK11
  • mitogen-activated protein kinase 11
  • Mitogen-activated protein kinase p38 beta
  • mitogen-activated protein kinase p38-2
  • MPK11
  • p38 beta
  • p38b
  • p38beta
  • P38BETA2
  • PRKM11
  • SAPK2B
  • SAPK2p38-2P38B
  • Stress-activated protein kinase 2
  • stress-activated protein kinase-2
  • stress-activated protein kinase-2b

Background

MAPK11 is encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation, and development. This kinase is most closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and environmental stress. This kinase is activated through its phosphorylation by MAP kinase kinases (MKKs), preferably by MKK6. Transcription factor ATF2/CREB2 has been shown to be a substrate of this kinase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

p38 alpha Antibody
[Unconjugated]
AF8691
Simple Western p38 alpha Antibody [Unconjugated]
Western Blot p38 alpha Antibody [Unconjugated]
Immunohistochemistry p38 alpha Antibody [Unconjugated]
(1 Review)
(11 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
POLDIP2 Antibody
NBP1-68874
Western Blot POLDIP2 Antibody
Western Blot POLDIP2 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
AHSA1 Antibody
(1A2-A8)
H00010598-M01
Western Blot AHSA1 Antibody (1A2-A8)
Sandwich ELISA AHSA1 Antibody (1A2-A8)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Crk Antibody
(3G11E8) - BSA Free
NBP2-37568
ELISA Crk Antibody (3G11E8) - BSA Free
Western Blot Crk Antibody (3G11E8) - BSA Free
Western Blot Crk Antibody (3G11E8) - BSA Free
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
GRAP2 Antibody
(OTI1G2)
NBP2-00764
Flow Cytometry GRAP2 Antibody (OTI1G2)
Flow Cytometry GRAP2 Antibody (OTI1G2)
Western Blot GRAP2 Antibody (OTI1G2)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
AIMP2 Antibody
NBP1-81575
Immunohistochemistry-Paraffin AIMP2 Antibody
Immunohistochemistry-Paraffin AIMP2 Antibody
Immunohistochemistry-Paraffin AIMP2 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
JNK1 Antibody
(OTI4E3)
NBP1-48284
Western Blot JNK1 Antibody (OTI4E3)
Immunocytochemistry/ Immunofluorescence JNK1 Antibody (OTI4E3)
Immunohistochemistry-Paraffin JNK1 Antibody (OTI4E3)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
p38 gamma/SAPK3
Antibody [Unconjugate
AF1347
Immunocytochemistry p38 gamma/SAPK3 Antibody [Unconjugated]
Simple Western p38 gamma/SAPK3 Antibody [Unconjugated]
Western Blot p38 gamma/SAPK3 Antibody [Unconjugated]
(8 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
SGSM3 Antibody
NBP2-13304
Immunohistochemistry-Paraffin SGSM3 Antibody
Immunocytochemistry/ Immunofluorescence SGSM3 Antibody
Western Blot SGSM3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
p38 delta/SAPK4
Antibody [Unconjugate
AF1519
Western Blot p38 delta/SAPK4 Antibody [Unconjugated]
Immunohistochemistry p38 delta/SAPK4 Antibody [Unconjugated]
Immunohistochemistry p38 delta/SAPK4 Antibody [Unconjugated]
(2 Publications)
Species: Hu
Applications: IHC, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(821 Publications)
Species: Hu
Applications: BA
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
EphB2 Antibody
[Unconjugated]
AF467
Simple Western EphB2 Antibody [Unconjugated]
Western Blot EphB2 Antibody [Unconjugated]
Immunocytochemistry EphB2 Antibody [Unconjugated]
(5 Reviews)
(63 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
MKK6/MEK6 Antibody
NBP1-87791
Immunohistochemistry-Paraffin MKK6/MEK6 Antibody
Immunohistochemistry-Paraffin MKK6/MEK6 Antibody
Immunohistochemistry-Paraffin MKK6/MEK6 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
JNK2 Antibody
(252320) [Unconjugate
MAB1846
Western Blot JNK2 Antibody (252320) [Unconjugated]
Knockout Validated JNK2 Antibody (252320) [Unconjugated]
Immunocytochemistry JNK2 Antibody (252320) [Unconjugated]
(2 Reviews)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
FAK Antibody
(495919) [Unconjugate
MAB4467
Immunohistochemistry FAK Antibody (495919) [Unconjugated]
Western Blot FAK Antibody (495919) [Unconjugated]
Knockout Validated FAK Antibody (495919) [Unconjugated]
(2 Publications)
Species: Hu
Applications: IHC, KO, Simple Western, WB

Publications for p38 beta/MAPK11 Recombinant Protein Antigen (NBP2-48826PEP) (0)

There are no publications for p38 beta/MAPK11 Recombinant Protein Antigen (NBP2-48826PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for p38 beta/MAPK11 Recombinant Protein Antigen (NBP2-48826PEP) (0)

There are no reviews for p38 beta/MAPK11 Recombinant Protein Antigen (NBP2-48826PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for p38 beta/MAPK11 Recombinant Protein Antigen (NBP2-48826PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional p38 beta/MAPK11 Products

Research Areas for p38 beta/MAPK11 Recombinant Protein Antigen (NBP2-48826PEP)

Find related products by research area.

Blogs on p38 beta/MAPK11

There are no specific blogs for p38 beta/MAPK11, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our p38 beta/MAPK11 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MAPK11