![Recombinant Human Orexin R2/HCRTR2 Protein [H00003062-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.](http://images.novusbio.com/fullsize/qc_test-H00003062-Q01-1.jpg "Recombinant Human Orexin R2/HCRTR2 Protein [H00003062-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA, MA, AP |
| Description | A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-54 of Human Orexin R2/HCRTR2 Source: Wheat Germ (in vitro) Amino Acid Sequence: MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYE |
| Preparation Method |
in vitro wheat germ expression system |
| Details of Functionality | This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated. |
| Source | Wheat germ |
| Protein/Peptide Type | Recombinant Protein |
| Gene | HCRTR2 |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Dilutions |
|
|
| Theoretical MW | 31.68 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Reviewed Applications |
|
|
| Publications |
|
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
| Buffer | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
| Preservative | No Preservative |
| Purity | >80% by SDS-PAGE and Coomassie blue staining |
| Publication using H00003062-Q01 | Applications | Species |
|---|---|---|
| Butterick TA, Nixon JP, Billington CJ et al. Orexin A decreases lipid peroxidation and apoptosis in a novel hypothalamic cell model Neurosci Lett 2012-07-11 [PMID: 22796468] (WB, Rat) | WB | Rat |
| Images | Ratings | Applications | Species | Date | Details | ||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Verified Customer |
WB | Human | 06/08/2011 |
Summary
|
Research Areas for Orexin R2/HCRTR2 Partial Recombinant Protein (H00003062-Q01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | HCRTR2 |
![Immunohistochemistry Orexin A/Hypocretin-1 Antibody (97505) [Unconjugated]](https://images.novusbio.com/images2/mab763_human-mouse-rat-orexin-a-hypocretin-1-mab-clone-97505-immunohistochemistry-30112022115129.jpg)
![Immunocytochemistry CD200R1 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD200_R1_AF2554_Immunocytochemistry__Immunofluorescence_17385.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![N/A Leptin/OB [HRP]](https://images.novusbio.com/images2/Leptin_DLP00_ELISA_134.jpg)
![N/A Leptin/OB [HRP]](https://images.novusbio.com/images2/DATA_Leptin_DLP00_ELISA_749.jpg)
![Immunohistochemistry Endorepellin/Perlecan/Heparan Sulfate Proteoglycan Antibody [Unconjugated]](https://images.novusbio.com/images2/Endorepellin_AF2364_Immunohistochemistry_6744.jpg)
![Western Blot: Orexin R2/HCRTR2 Antibody (1E3) [H00003062-M01] - Analysis of HCRTR2 expression in transfected 293T cell line by HCRTR2 monoclonal antibody (M01), clone 1E3.Lane 1: HCRTR2 transfected lysate(50.7 KDa).Lane 2: Non-transfected lysate.](https://images.novusbio.com/images/Orexin-R2-HCRTR2-Antibody-1E3-Western-Blot-H00003062-M01-img0006.jpg "Western Blot: Orexin R2/HCRTR2 Antibody (1E3) [H00003062-M01] - Analysis of HCRTR2 expression in transfected 293T cell line by HCRTR2 monoclonal antibody (M01), clone 1E3.Lane 1: HCRTR2 transfected lysate(50.7 KDa).Lane 2: Non-transfected lysate.")
