Home » Orexin R1/HCRTR1 » HCRTR1 Peptides and Proteins » Orexin R1/HCRTR1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Orexin R1/HCRTR1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Orexin R1/HCRTR1 Protein (NBP1-82463PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Orexin R1/HCRTR1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HCRTR1.

Source: E. coli

Amino Acid Sequence: MEPSATPGAQMGVPPGSREPSPVPPDYEDEFLRYLWRDYLYPKQYEWV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HCRTR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82463.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Orexin R1/HCRTR1 Recombinant Protein Antigen

  • HCRTR1
  • hypocretin (orexin) receptor 1
  • hypocretin receptor 1
  • Hypocretin receptor type 1
  • hypocretin receptor-1
  • Orexin R1
  • orexin receptor 1
  • orexin receptor type 1
  • orexin receptor-1
  • OrexinR1
  • OX1R
  • ox-1-R
  • ox1-R

Background

HCRTR1, or orexin 1 receptor (OX1R), is a G-protein coupled receptor expressed in the hypothalamus and involved in the regulation of feeding behaviour. HCRTR1 selectively binds the orexin A neuropeptide. It shares 64% identity with HCRTR2. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Orexin
A/Hypocretin-1 Antibo ...
MAB763
Immunohistochemistry Orexin A/Hypocretin-1 Antibody (97505) [Unconjugated]
(19 Publications)
Species: Hu, Mu
Applications: IHC
Orexin R2/HCRTR2
Antibody (1E3)
H00003062-M01
Western Blot Orexin R2/HCRTR2 Antibody (1E3)
ELISA Orexin R2/HCRTR2 Antibody (1E3)
Western Blot Orexin R2/HCRTR2 Antibody (1E3)
(1 Review)
(1 Publication)
Species: Hu
Applications: ELISA, KD, WB
CD200R1 Antibody
[Unconjugated]
AF2554
Immunocytochemistry CD200R1 Antibody [Unconjugated]
(8 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, ICC, WB
Neuropeptide Y
Antibody
NBP1-46535
Immunohistochemistry Neuropeptide Y Antibody
(20 Publications)
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
POMC Antibody
NB100-1533
Flow Cytometry POMC Antibody
Immunohistochemistry POMC Antibody
Immunohistochemistry POMC Antibody
(10 Publications)
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Corticotropin
Releasing Factor Anti ...
H00001392-M02
Western Blot Corticotropin Releasing Factor Antibody (2B11)
Sandwich ELISA Corticotropin Releasing Factor Antibody (2B11)
(4 Publications)
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Leptin/OB [HRP]
DLP00
N/A Leptin/OB [HRP]
N/A Leptin/OB [HRP]
(151 Publications)
Species: Hu
Applications: ELISA
OXR1 Antibody
NBP1-86391
Immunohistochemistry-Paraffin OXR1 Antibody
Immunohistochemistry-Paraffin OXR1 Antibody
Immunohistochemistry-Paraffin OXR1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
PLOD1 Antibody
NBP2-38770
Western Blot PLOD1 Antibody
Western Blot PLOD1 Antibody
Western Blot PLOD1 Antibody
(3 Publications)
Species: Hu, Mu
Applications: IHC-P, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB

Publications for Orexin R1/HCRTR1 Protein (NBP1-82463PEP) (0)

There are no publications for Orexin R1/HCRTR1 Protein (NBP1-82463PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Orexin R1/HCRTR1 Protein (NBP1-82463PEP) (0)

There are no reviews for Orexin R1/HCRTR1 Protein (NBP1-82463PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Orexin R1/HCRTR1 Protein (NBP1-82463PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Orexin R1/HCRTR1 Products

Research Areas for Orexin R1/HCRTR1 Protein (NBP1-82463PEP)

Find related products by research area.

Blogs on Orexin R1/HCRTR1

There are no specific blogs for Orexin R1/HCRTR1, but you can read our latest blog posts.

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Orexin R1/HCRTR1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol HCRTR1