![Immunohistochemistry-Paraffin: OPALIN Antibody (CL11142) [NBP3-07995] - Staining of human kidney shows no positivity in cells in tubules as expected.](http://images.novusbio.com/fullsize/OPALIN-Antibody-CL11142-Immunohistochemistry-Paraffin-NBP3-07995-img0004.jpg "Immunohistochemistry-Paraffin: OPALIN Antibody (CL11142) [NBP3-07995] - Staining of human kidney shows no positivity in cells in tubules as expected.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clone | CL11144 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: RRRSSIEAMEESDRPCEISEIDDNPKISENPRRSPTHEKNTMGAQEAHIYVKTVAGSEEPVHDRYRPTIEMERRRGLWWLVPRLSLE |
| Epitope | GSEEPVHDRY |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | OPALIN |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, pH 7.2, containing 40% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | OPALIN |
![Immunohistochemistry-Paraffin: OPALIN Antibody (CL11142) [NBP3-07995] - Analysis in human cerebral cortex and kidney tissues using NBP3-07995 antibody. Corresponding OPALIN RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/OPALIN-Antibody-CL11142-Immunohistochemistry-Paraffin-NBP3-07995-img0001.jpg "Immunohistochemistry-Paraffin: OPALIN Antibody (CL11142) [NBP3-07995] - Analysis in human cerebral cortex and kidney tissues using NBP3-07995 antibody. Corresponding OPALIN RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: OPALIN Antibody (CL11142) [NBP3-07995] - Staining of human cerebellum shows strong cytoplasmic positivity in oligodendrocytes.](http://images.novusbio.com/fullsize/OPALIN-Antibody-CL11142-Immunohistochemistry-Paraffin-NBP3-07995-img0002.jpg "Immunohistochemistry-Paraffin: OPALIN Antibody (CL11142) [NBP3-07995] - Staining of human cerebellum shows strong cytoplasmic positivity in oligodendrocytes.")
![Immunohistochemistry-Paraffin: OPALIN Antibody (CL11142) [NBP3-07995] - Staining of human cerebral cortex shows strong positivity in oligodendrocytes and myelinated fibers.](http://images.novusbio.com/fullsize/OPALIN-Antibody-CL11142-Immunohistochemistry-Paraffin-NBP3-07995-img0003.jpg "Immunohistochemistry-Paraffin: OPALIN Antibody (CL11142) [NBP3-07995] - Staining of human cerebral cortex shows strong positivity in oligodendrocytes and myelinated fibers.")
![Immunohistochemistry-Paraffin: OPALIN Antibody (CL11142) [NBP3-07995] - Staining of human prostate shows no positivity in glandular cells as expected.](http://images.novusbio.com/fullsize/OPALIN-Antibody-CL11142-Immunohistochemistry-Paraffin-NBP3-07995-img0005.jpg "Immunohistochemistry-Paraffin: OPALIN Antibody (CL11142) [NBP3-07995] - Staining of human prostate shows no positivity in glandular cells as expected.")
![Western Blot PDGFR alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/PDGF_R_alpha_AF1062_Western_Blot_20935.jpg)
![Immunohistochemistry PDGFR alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/PDGF_R_alpha_AF1062_Immunohistochemistry_6673.jpg)
![Neutralization PDGFR alpha Antibody [Unconjugated]](https://images.novusbio.com/images2/PDGF_R_alpha_AF1062_Block_Neutralize_8750.jpg)
![SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.](https://images.novusbio.com/images/Mouse-IgG1-Isotype-Control-MG1-SDS-Page-NBP1-97005-img0002.jpg "SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.")