![Immunohistochemistry-Paraffin: OLFM4 Antibody [NBP2-62720] - Staining of human small intestine shows high expression.](http://images.novusbio.com/fullsize/OLFM4-Antibody-Immunohistochemistry-Paraffin-NBP2-62720-img0002.jpg "Immunohistochemistry-Paraffin: OLFM4 Antibody [NBP2-62720] - Staining of human small intestine shows high expression.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KLVIQLKESFGGSSEIVDQLEVEIRNMTLLVEKLETLDKNNVLAIRREIVALKTKLKECEASKDQNTPVVHPPPTPGSCGHGGVVN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | OLFM4 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for OLFM4 Antibody (NBP2-62720)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | OLFM4 |
![Immunohistochemistry-Paraffin: OLFM4 Antibody [NBP2-62720] - Analysis in human small intestine and liver tissues using Anti-OLFM4 antibody. Corresponding OLFM4 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/OLFM4-Antibody-Immunohistochemistry-Paraffin-NBP2-62720-img0001.jpg "Immunohistochemistry-Paraffin: OLFM4 Antibody [NBP2-62720] - Analysis in human small intestine and liver tissues using Anti-OLFM4 antibody. Corresponding OLFM4 RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: OLFM4 Antibody [NBP2-62720] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/fullsize/OLFM4-Antibody-Immunohistochemistry-Paraffin-NBP2-62720-img0003.jpg "Immunohistochemistry-Paraffin: OLFM4 Antibody [NBP2-62720] - Staining of human liver shows low expression as expected.")
![Neutralization G-CSF Antibody (67604) [Unconjugated]](https://images.novusbio.com/images2/G-CSF_MAB414_Block_Neutralize_9188.jpg)
![Immunohistochemistry Reg4 Antibody [Unconjugated]](https://images.novusbio.com/images2/Reg4_AF1379_Immunohistochemistry_7311.jpg)
![SDS-PAGE EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236-EG_234.jpg)
![Bioactivity EGF [Unconjugated]](https://images.novusbio.com/images2/EGF_236EG_1570.jpg)
![Cell Culture EGF [Unconjugated]](https://images.novusbio.com/images/236-eg_recombinant-human-egf-protein-cf-bioactivity-25202394053.jpg)
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Immunohistochemistry CEACAM7 Antibody [Unconjugated]](https://images.novusbio.com/images2/CEACAM7_AF4478_Immunohistochemistry_20616.jpg)
![Western Blot CEACAM7 Antibody [Unconjugated]](https://images.novusbio.com/images2/CEACAM-7_AF4478_Western_Blot_5475.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")