![Western Blot: NUBP1 Antibody [H00004682-B01P] - Analysis of NUBP1 expression in COLO 320 HSR.](http://images.novusbio.com/fullsize/NUBP1-Antibody-Western-Blot-H00004682-B01P-img0005.jpg "Western Blot: NUBP1 Antibody [H00004682-B01P] - Analysis of NUBP1 expression in COLO 320 HSR.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | NUBP1 (NP_002475.2, 1 a.a. - 320 a.a.) full-length human protein. MEEVPHDCPGADSAQAGRGASCQGCPNQRLCASGAGATPDTAIEEIKEKMKTVKHKILVLSGKGGVGKSTFSAHLAHGLAEDENTQIALLDIDICGPSIPKIMGLEGEQVHQSGSGWSPVYVEDNLGVMSVGFLLSSPDDAVIWRGPKKNGMIKQFLRDVDWGEVDYLIVDTPPGTSDEHLSVVRYLATAHIDGAVIITTPQEVSLQDVRKEINFCRKVKLPIIGVVENMSGFICPKCKKESQIFPPTTGGAELMCQDLEVPLLGRVPLDPLIGKNCDKGQSFFIDAPDSPATLAYRSIIQRIQEFCNLHQSKEENLISS |
| Specificity | NUBP1 - nucleotide binding protein 1 (MinD homolog, E. coli), |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | NUBP1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It is also useful for IF. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
![Neutralization CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Block_Neutralize_9064.jpg)
![Immunocytochemistry CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Immunocytochemistry_9339.jpg)
![Western Blot CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/mab208_human-il-8-cxcl8-mab-clone-6217-western-blot-1882021143847.jpg)
| Publication using H00004682-B01P | Applications | Species |
|---|---|---|
| Seki M, Takeda Y, Iwai K, Tanaka K. IOP1 is an external component of human CIA machinery and functions in MMS19-dependent CIA pathway. J Biol Chem. 2013-04-12 [PMID: 23585563] |
Secondary Antibodies |
Isotype Controls |
Research Areas for NUBP1 Antibody (H00004682-B01P)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NUBP1 |
| Entrez |
|
| Uniprot |
|
![Immunocytochemistry/Immunofluorescence: NUBP1 Antibody [H00004682-B01P] - Analysis of purified antibody to NUBP1 on HeLa cell. (antibody concentration 10 ug/ml)](http://images.novusbio.com/fullsize/NUBP1-Antibody-Immunocytochemistry-Immunofluorescence-H00004682-B01P-img0004.jpg "Immunocytochemistry/Immunofluorescence: NUBP1 Antibody [H00004682-B01P] - Analysis of purified antibody to NUBP1 on HeLa cell. (antibody concentration 10 ug/ml)")
![Western Blot: NUBP1 Antibody [H00004682-B01P] - Analysis of NUBP1 expression in transfected 293T cell line by NUBP1 polyclonal antibody. Lane 1: NUBP1 transfected lysate(35.2 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/NUBP1-Antibody-Western-Blot-H00004682-B01P-img0006.jpg "Western Blot: NUBP1 Antibody [H00004682-B01P] - Analysis of NUBP1 expression in transfected 293T cell line by NUBP1 polyclonal antibody. Lane 1: NUBP1 transfected lysate(35.2 KDa). Lane 2: Non-transfected lysate.")
![Azurocidin/CAP37/HBP Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Azurocidin/CAP37/HBP Antibody [Unconjugated]")
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![SDS-PAGE IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images2/IL-1_beta_201-LB_304.jpg)
![Bioactivity IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images2/IL-1_beta_201-LB_306.jpg)
![SEC-MALS IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images/201-lb_recombinant-human-il-1-beta-il-1f2-protein-sec-mals-123202491556.jpg)
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")