![Western Blot: NSFL1C Antibody [NBP2-13676] - Analysis using Anti-NSFL1C antibody NBP2-13676 (A) shows similar pattern to independent antibody NBP2-13677 (B).](http://images.novusbio.com/fullsize/NSFL1C-Antibody-Western-Blot-NBP2-13676-img0006.jpg "Western Blot: NSFL1C Antibody [NBP2-13676] - Analysis using Anti-NSFL1C antibody NBP2-13676 (A) shows similar pattern to independent antibody NBP2-13677 (B).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: MAAERQEALREFVAVTGAEEDRARFFLESAGWDLQIALASFYEDGGDEDIVTISQATPSSVSRGTAPSDNRVTSFRDLIHDQDADEE |
| Predicted Species | Mouse (94%), Rat (95%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NSFL1C |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NSFL1C |
![Immunocytochemistry/Immunofluorescence: NSFL1C Antibody [NBP2-13676] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol.](http://images.novusbio.com/fullsize/NSFL1C-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13676-img0004.jpg "Immunocytochemistry/Immunofluorescence: NSFL1C Antibody [NBP2-13676] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol.")
![Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13676] - Staining of human kidney.](http://images.novusbio.com/fullsize/NSFL1C-Antibody-Immunohistochemistry-Paraffin-NBP2-13676-img0009.jpg "Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13676] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13676] - Staining of human testis shows distinct nuclear and cytoplasmic positivity in cells in seminiferus ducts.](http://images.novusbio.com/fullsize/NSFL1C-Antibody-Immunohistochemistry-Paraffin-NBP2-13676-img0001.jpg "Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13676] - Staining of human testis shows distinct nuclear and cytoplasmic positivity in cells in seminiferus ducts.")
![Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13676] - Staining of human cerebral cortex, kidney, lymph node and testis using Anti-NSFL1C antibody NBP2-13676 (A) shows similar protein distribution across tissues to independent antibody NBP2-13677 (B).](http://images.novusbio.com/fullsize/NSFL1C-Antibody-Immunohistochemistry-Paraffin-NBP2-13676-img0005.jpg "Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13676] - Staining of human cerebral cortex, kidney, lymph node and testis using Anti-NSFL1C antibody NBP2-13676 (A) shows similar protein distribution across tissues to independent antibody NBP2-13677 (B).")
![Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13676] - Staining of human testis.](http://images.novusbio.com/fullsize/NSFL1C-Antibody-Immunohistochemistry-Paraffin-NBP2-13676-img0007.jpg "Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13676] - Staining of human testis.")
![Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13676] - Staining of human cerebral cortex.](http://images.novusbio.com/fullsize/NSFL1C-Antibody-Immunohistochemistry-Paraffin-NBP2-13676-img0008.jpg "Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13676] - Staining of human cerebral cortex.")
![Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13676] - Staining of human lymph node.](http://images.novusbio.com/fullsize/NSFL1C-Antibody-Immunohistochemistry-Paraffin-NBP2-13676-img0010.jpg "Immunohistochemistry-Paraffin: NSFL1C Antibody [NBP2-13676] - Staining of human lymph node.")
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunohistochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunohistochemistry_16919.jpg)
![Immunocytochemistry p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images2/p63_AF1916_Immunocytochemistry__Immunofluorescence_16973.jpg)
![Immunocytochemistry/ Immunofluorescence p63/TP73L Antibody [Unconjugated]](https://images.novusbio.com/images/af1916_human-p63-tp73l-affinity-purified-polyclonal-ab-41202412401237.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")