![Western Blot: Nrf1 Antibody (4Q4E7) [NBP3-16161] - Western blot analysis of extracts of various cell lines, using Nrf1 Rabbit mAb (NBP3-16161) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.](http://images.novusbio.com/fullsize/Nrf1-Antibody-4Q4E7-Western-Blot-NBP3-16161-img0003.jpg "Western Blot: Nrf1 Antibody (4Q4E7) [NBP3-16161] - Western blot analysis of extracts of various cell lines, using Nrf1 Rabbit mAb (NBP3-16161) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC, IP, ChIP |
| Clone | 4Q4E7 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 300-400 of human NRF1 (Q16656). LVPSQTVVQTFSNPDGTVSLIQVGTGATVATLADASELPTTVTVAQVNYSAVADGEVEQNWATLQGGEMTIQTTQASEATQAVASLAEAAVAASQEMQQGA |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | NRF1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Nrf1 Antibody (NBP3-16161)Find related products by research area.
|
|
Losing memory: Toxicity from mutant APP and amyloid beta explain the hippocampal neuronal damage in Alzheimer's disease By Jamshed Arslan Pharm.D. Alzheimer's disease (AD) is an irreversible brain disorder that destroys memory and thinking skills. The telltale signs of AD brains are extracellular deposits of amy... Read full blog post. |
|
PGC-1 alpha: Roles in Mitochondrial Biogenesis and Disease An important aspect of mitochondria maintenance includes biogenesis to replenish damaged and degraded mitochondrial structures. The regulation of mitochondrial biogenesis is very complex and numerous genes regulate and synchronize protein synthesis fr... Read full blog post. |
|
Exploring the Many Roles of PGC-1 alpha The peroxisome proliferator-activated receptor gamma, co-activator 1 (PGC-1 alpha or PPARGC1A) gene encodes a 91 kDa nuclear protein that acts as a transcriptional co-activator involved in energy metabolism. Interaction with PPAR gamma allows it to in... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NRF1 |
![Immunohistochemistry-Paraffin: Nrf1 Antibody (4Q4E7) [NBP3-16161] - Immunohistochemistry of paraffin-embedded human colon using Nrf1 Rabbit mAb (NBP3-16161) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/Nrf1-Antibody-4Q4E7-Immunohistochemistry-Paraffin-NBP3-16161-img0001.jpg "Immunohistochemistry-Paraffin: Nrf1 Antibody (4Q4E7) [NBP3-16161] - Immunohistochemistry of paraffin-embedded human colon using Nrf1 Rabbit mAb (NBP3-16161) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.")
![Western Blot: Nrf1 Antibody (4Q4E7) [NBP3-16161] - Western blot analysis of extracts of various cell lines, using Nrf1 Rabbit mAb (NBP3-16161) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.](http://images.novusbio.com/fullsize/Nrf1-Antibody-4Q4E7-Western-Blot-NBP3-16161-img0002.jpg "Western Blot: Nrf1 Antibody (4Q4E7) [NBP3-16161] - Western blot analysis of extracts of various cell lines, using Nrf1 Rabbit mAb (NBP3-16161) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.")
![Chromatin Immunoprecipitation: Nrf1 Antibody (4Q4E7) [NBP3-16161] - Analysis of extracts of HepG2 cells, using NRF1 antibody (A3252) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.](http://images.novusbio.com/fullsize/nbp3-16161_rabbit-nrf1-mab-4q4e7-chromatin-immunoprecipitation-193202413322..jpg "Chromatin Immunoprecipitation: Nrf1 Antibody (4Q4E7) [NBP3-16161] - Analysis of extracts of HepG2 cells, using NRF1 antibody (A3252) and rabbit IgG.The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram was constructed by the ratios of the immunoprecipitated DNA to the input.")
![ChIP sequencing-Nrf1 Antibody (4Q4E7) [NBP3-16161] - CUT&Tag was performed using the CUT&Tag Assay Kit for Illumina from 10⁵ HepG2 cells with 1 μg NRF1 Rabbit mAb along with a Goat Anti-Rabbit IgG(H+L). The CUT&Tag results indicate the enrichment pattern of NRF1 in representative gene loci (LINS1), as shown in figure.](http://images.novusbio.com/fullsize/nbp3-16161_rabbit-nrf1-mab-4q4e7-chromatin-immunoprecipitation-sequencing-203202463743..jpg "ChIP sequencing-Nrf1 Antibody (4Q4E7) [NBP3-16161] - CUT&Tag was performed using the CUT&Tag Assay Kit for Illumina from 10⁵ HepG2 cells with 1 μg NRF1 Rabbit mAb along with a Goat Anti-Rabbit IgG(H+L). The CUT&Tag results indicate the enrichment pattern of NRF1 in representative gene loci (LINS1), as shown in figure.")
![Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Western_Blot_18923.jpg)
![Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Immunocytochemistry__Immunofluorescence_18945.jpg)
![Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]](https://images.novusbio.com/images2/cJun_MAB8930_Simple_Western_19175.jpg)
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/DATA_PSG1_DPSG10_ELISA_797.jpg)
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/PSG-1_DPSG10_ELISA_164.jpg)
![COCO/DAND5 [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "COCO/DAND5 [Unconjugated]")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")