![Immunohistochemistry-Paraffin: NQO-1 Antibody [NBP1-85223] - Staining in human stomach and lymph node tissues.. Corresponding NQO1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/NQO-1-Antibody-Immunohistochemistry-Paraffin-NBP1-85223-img0014.jpg "Immunohistochemistry-Paraffin: NQO-1 Antibody [NBP1-85223] - Staining in human stomach and lymph node tissues.. Corresponding NQO1 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FRSKKAVLSITTGGSGSMYSLQGIHGDMNVILWPIQSGILHFCGFQVLEPQLTYSIGHTPADARIQILEGWKKRLENIWDETPLYFAPSSLFDLNFQAGFLMKKEVQDEEKNKKFGLSVGHHLGKSIPTDNQIKAR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NQO1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | IHC reported in scientific literature (PMID: 26422507). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for NQO-1 Antibody (NBP1-85223)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NQO1 |
![Western Blot: NQO-1 Antibody [NBP1-85223] - Analysis in human cell lines A-549 and HEK293 using Anti-NQO1 antibody. Corresponding NQO1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.](http://images.novusbio.com/fullsize/NQO-1-Antibody-Western-Blot-NBP1-85223-img0010.jpg "Western Blot: NQO-1 Antibody [NBP1-85223] - Analysis in human cell lines A-549 and HEK293 using Anti-NQO1 antibody. Corresponding NQO1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.")
![Immunocytochemistry/Immunofluorescence: NQO-1 Antibody [NBP1-85223] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/NQO-1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85223-img0008.jpg "Immunocytochemistry/Immunofluorescence: NQO-1 Antibody [NBP1-85223] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: NQO-1 Antibody [NBP1-85223] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/NQO-1-Antibody-Immunohistochemistry-Paraffin-NBP1-85223-img0017.jpg "Immunohistochemistry-Paraffin: NQO-1 Antibody [NBP1-85223] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: NQO-1 Antibody [NBP1-85223] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/NQO-1-Antibody-Immunohistochemistry-Paraffin-NBP1-85223-img0015.jpg "Immunohistochemistry-Paraffin: NQO-1 Antibody [NBP1-85223] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: NQO-1 Antibody [NBP1-85223] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/NQO-1-Antibody-Immunohistochemistry-Paraffin-NBP1-85223-img0016.jpg "Immunohistochemistry-Paraffin: NQO-1 Antibody [NBP1-85223] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: NQO-1 Antibody [NBP1-85223] - Staining of human lymph node shows no positivity in non - germinal center cells as expected.](http://images.novusbio.com/fullsize/NQO-1-Antibody-Immunohistochemistry-Paraffin-NBP1-85223-img0018.jpg "Immunohistochemistry-Paraffin: NQO-1 Antibody [NBP1-85223] - Staining of human lymph node shows no positivity in non - germinal center cells as expected.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot Keap1 Antibody (333116) [Unconjugated]](https://images.novusbio.com/images2/Keap1_MAB3024_Western_Blot_6061.jpg)
![Simple Western Keap1 Antibody (333116) [Unconjugated]](https://images.novusbio.com/images2/Keap1_MAB3024_Simple_Western_16632.jpg)
![Knockout Validated Keap1 Antibody (333116) [Unconjugated]](https://images.novusbio.com/images2/Keap1_MAB3024_Knockout_Validated_23684.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")