nNOS Antibody (5K9R2) Summary
Additional Information |
Recombinant Monoclonal Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1335-1434 of human nNOS (P29475). QLAESVYRALKEQGGHIYVCGDVTMAADVLKAIQRIMTQQGKLSAEDAGVFISRMRDDNRYHEDIFGVTLRTYEVTNRLRSESIAFIEESKKDTDEVFSS |
Isotype |
IgG |
Clonality |
Monoclonal |
Host |
Rabbit |
Gene |
NOS1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS, 0.05% BSA, 50% glycerol, pH7.3 |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for nNOS Antibody (5K9R2)
Background
NOS (nitric oxide synathase) is a mediator of NO (nitric oxide) production, an inorganic gaseous messenger between cells. In cells, NOS catalyzes the oxidization of L-arginine to produce L-citrulline and NO. Three isoforms of NOS has been identified (eNOS, iNOS, and nNOS) with all of them having binding sites for NADPH, FAD, FMN, and tetrahydrobiopterin (1). Specifically, nNOS (Neuronal nitric oxide synthase bNOS, cNOS, Type I) is bound to PSD95 located in the neuronal membrane and at increased level of Ca2+, nNOS is trasnlocated to cytoplasm. In cytoplasm, nNOS is dephosphorylated by calcineurin which initiates NO production (2). A phosphorylation by PKA and PKC on nNOS leads down-regulation of NO production.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, WB
Species: Am, Bv, Ca, Dr, Hu, Mu, Po, Rt, Sh
Applications: IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Publications for nNOS Antibody (NBP3-16008) (0)
There are no publications for nNOS Antibody (NBP3-16008).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for nNOS Antibody (NBP3-16008) (0)
There are no reviews for nNOS Antibody (NBP3-16008).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for nNOS Antibody (NBP3-16008) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional nNOS Products
Research Areas for nNOS Antibody (NBP3-16008)
Find related products by research area.
|
Blogs on nNOS