![Immunohistochemistry-Paraffin: NHE1/SLC9A1 Antibody [NBP2-38683] - Staining in human stomach and liver tissues using NBP2-38683 antibody. Corresponding SLC9A1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/NHE1-SLC9A1-Antibody-Immunohistochemistry-Paraffin-NBP2-38683-img0016.jpg "Immunohistochemistry-Paraffin: NHE1/SLC9A1 Antibody [NBP2-38683] - Staining in human stomach and liver tissues using NBP2-38683 antibody. Corresponding SLC9A1 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SPESVDLVNEELKGKVLGLSRDPAKVAEEDEDDDGGIMMRSKETSSPGTDDVFTPAPSDSPSSQRIQRCLSDPGPHPEPGEGEPFFPKG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SLC9A1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Simple_Western_21454.jpg)
![Western Blot EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Western_Blot_21511.jpg)
![Immunocytochemistry EphB2 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphB2_AF467_Immunocytochemistry__Immunofluorescence_17288.jpg)
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for NHE1/SLC9A1 Antibody (NBP2-38683)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: NHE1/SLC9A1 Antibody [NBP2-38683] - Staining of human kidney, liver, prostate and stomach. (A) shows similar protein distribution across tissues to independent antibody (B).](http://images.novusbio.com/fullsize/NHE1-SLC9A1-Antibody-Immunohistochemistry-Paraffin-NBP2-38683-img0017.jpg "Immunohistochemistry-Paraffin: NHE1/SLC9A1 Antibody [NBP2-38683] - Staining of human kidney, liver, prostate and stomach. (A) shows similar protein distribution across tissues to independent antibody (B).")
![Immunocytochemistry/Immunofluorescence: NHE1/SLC9A1 Antibody [NBP2-38683] - Staining of human cell line A-431 shows localization to plasma membrane. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/NHE1-SLC9A1-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38683-img0004.jpg "Immunocytochemistry/Immunofluorescence: NHE1/SLC9A1 Antibody [NBP2-38683] - Staining of human cell line A-431 shows localization to plasma membrane. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: NHE1/SLC9A1 Antibody [NBP2-38683] - Staining of human kidney shows moderate membranous/cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/NHE1-SLC9A1-Antibody-Immunohistochemistry-Paraffin-NBP2-38683-img0011.jpg "Immunohistochemistry-Paraffin: NHE1/SLC9A1 Antibody [NBP2-38683] - Staining of human kidney shows moderate membranous/cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: NHE1/SLC9A1 Antibody [NBP2-38683] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/NHE1-SLC9A1-Antibody-Immunohistochemistry-Paraffin-NBP2-38683-img0013.jpg "Immunohistochemistry-Paraffin: NHE1/SLC9A1 Antibody [NBP2-38683] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: NHE1/SLC9A1 Antibody [NBP2-38683] - Staining of human prostate shows moderate membranous/cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/NHE1-SLC9A1-Antibody-Immunohistochemistry-Paraffin-NBP2-38683-img0014.jpg "Immunohistochemistry-Paraffin: NHE1/SLC9A1 Antibody [NBP2-38683] - Staining of human prostate shows moderate membranous/cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: NHE1/SLC9A1 Antibody [NBP2-38683] - Staining of human stomach shows strong membranous/cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/NHE1-SLC9A1-Antibody-Immunohistochemistry-Paraffin-NBP2-38683-img0015.jpg "Immunohistochemistry-Paraffin: NHE1/SLC9A1 Antibody [NBP2-38683] - Staining of human stomach shows strong membranous/cytoplasmic positivity in glandular cells.")
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images/mab25031_human-cftr-c-terminus-mab-clone-24-1-41202412513815.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")