Home » NGX6 » NGX6 Proteins » Recombinant Human NGX6 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human NGX6 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Recombinant Human NGX6 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-257 of Human C9orf127

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MWRPHFHTCPPQSSVRQENVTVFGCLTHEVPLSLGDAAVTCSKESLAGFLLSVSATTRVARLRIPFPQTGTWFLALRSLCGVGPRFVRCRNATAEVRMRTFLSPCVDDCGPYGQCKLLRTHNYLYAACECKAGWRGWGCTDSADALTYGFQLLSTLLLCLSNLMFLPPVVLAIRSRYVLEAAVYTFTMFFSTVCGGVCILSLGACAWWWVTVCISTTFSEGLGMSVPSLCLLQTETAVLPKLSCIDNGHFCKTHWSK
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
TMEM8B
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
54.7 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NGX6 GST (N-Term) Protein

  • C9orf127
  • chromosome 9 open reading frame 127
  • NAG-5
  • nasopharyngeal carcinoma expressed 6
  • nasopharyngeal carcinoma related protein
  • Nasopharyngeal carcinoma-associated gene 6 protein
  • NGX6MGC120460
  • Protein NAG-5
  • Protein NGX6
  • RP11-112J3.10
  • transmembrane protein 8B

Background

TMEM8B may function as a regulator of the EGFR pathway. Probable tumor suppressor which may function in cell growth, proliferation and adhesion

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Cyclin D1 Antibody
(SPM587)
NBP2-32840
Western Blot Cyclin D1 Antibody (SPM587)
Flow Cytometry Cyclin D1 Antibody (SPM587)
Flow Cytometry Cyclin D1 Antibody (SPM587)
(1 Review)
(9 Publications)
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
c-Myc Antibody
(9E10) - BSA Free
NB600-302
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Flow Cytometry c-Myc Antibody (9E10) - BSA Free
Western Blot c-Myc Antibody (9E10) - BSA Free
(4 Reviews)
(46 Publications)
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Niemann-Pick C1
Antibody - BSA Free
NB400-148
Immunocytochemistry/ Immunofluorescence Niemann-Pick C1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Niemann-Pick C1 Antibody - BSA Free
Immunohistochemistry-Paraffin Niemann-Pick C1 Antibody - BSA Free
(6 Reviews)
(54 Publications)
Species: ChHa, Ha, Hu, Mu, Po, Pm, Rt
Applications: EM, ICC/IF, IHC, IHC-P, IP, KD, KO, WB
PLUNC Antibody
AF4274
Western Blot PLUNC Antibody
Immunohistochemistry PLUNC Antibody
Western Blot PLUNC Antibody
(5 Publications)
Species: Mu
Applications: IHC, WB
Ezrin Antibody
NBP2-16396
Immunohistochemistry-Paraffin Ezrin Antibody
Immunohistochemistry-Paraffin Ezrin Antibody
Western Blot Ezrin Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-P, WB
beta-Catenin
Antibody [Unconjugate
AF1329
Western Blot beta-Catenin Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) beta-Catenin Antibody [Unconjugated]
Simple Western beta-Catenin Antibody [Unconjugated]
(2 Reviews)
(31 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
BRD7 Antibody
NBP1-28727
Immunohistochemistry-Paraffin BRD7 Antibody
Western Blot BRD7 Antibody
Immunoprecipitation BRD7 Antibody
(1 Publication)
Species: Hu, Mu
Applications: Flow, IHC, IHC-P, IP, WB
JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western Blot JNK1 Antibody (228601) [Unconjugated]
Western Blot JNK1 Antibody (228601) [Unconjugated]
Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
(1 Review)
(19 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
TCF4 Antibody (1G4)
H00006925-M03
ELISA TCF4 Antibody (1G4)
Immunocytochemistry/ Immunofluorescence TCF4 Antibody (1G4)
Western Blot TCF4 Antibody (1G4)
(1 Review)
(7 Publications)
Species: Hu, Pm, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
TCF7L2 Antibody
(3A4)
H00006934-M06
ELISA TCF7L2 Antibody (3A4)
Immunocytochemistry/ Immunofluorescence TCF7L2 Antibody (3A4)
Immunohistochemistry-Paraffin TCF7L2 Antibody (3A4)
(1 Review)
(1 Publication)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(795 Publications)
Species: Hu
Applications: BA
COX-2 Antibody
NB100-689
Immunohistochemistry-Paraffin COX-2 Antibody
Simple Western COX-2 Antibody
(1 Review)
(36 Publications)
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
UBAP1 Antibody
NBP1-80651
Immunocytochemistry/ Immunofluorescence UBAP1 Antibody
Western Blot UBAP1 Antibody
Immunohistochemistry-Paraffin UBAP1 Antibody
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
JunD Antibody
(512709)
MAB5526
Western Blot JunD Antibody (512709)
(2 Publications)
Species: Hu, Mu
Applications: WB
JunB/AP-1 Antibody
NBP1-89544
Immunocytochemistry/ Immunofluorescence JunB/AP-1 Antibody
Immunohistochemistry-Paraffin JunB/AP-1 Antibody
Immunohistochemistry-Paraffin JunB/AP-1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB

Publications for NGX6 Recombinant Protein (H00051754-P01) (0)

There are no publications for NGX6 Recombinant Protein (H00051754-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NGX6 Recombinant Protein (H00051754-P01) (0)

There are no reviews for NGX6 Recombinant Protein (H00051754-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NGX6 Recombinant Protein (H00051754-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NGX6 Products

Research Areas for NGX6 Recombinant Protein (H00051754-P01)

Find related products by research area.

Blogs on NGX6

There are no specific blogs for NGX6, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Immunocytochemistry/Immunofluorescence: Niemann-Pick C1 Antibody - BSA Free [NB400-148] - Immunocytochemical staining with corresponding colocalization analysis of ALIX (green) and NPC-1 (red) in fibroblasts exposed to LLOMe for 15 min. Nuclei are stained with DAPI (blue) and merged images show colocalization in yellow (n = 5). Image collected and cropped by CiteAb from the following publication (//pubmed.ncbi.nlm.nih.gov/32409651/) licensed under a CC-BY license.
Niemann-Pick C1 Antibody - BSA Free
NB400-148

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NGX6 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol TMEM8B