Home » NF2/Merlin » Merlin Peptides and Proteins » Recombinant Human NF2/Merlin GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human NF2/Merlin GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
SDS-Page: Recombinant Human NF2/Merlin Protein [H00004771-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
SDS-Page: Recombinant Human NF2/Merlin Protein [H00004771-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, PAGE, AP

Order Details

100% Guarantee on every product

Recombinant Human NF2/Merlin GST (N-Term) Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 82 of Human NF2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MVVSLRALLLALRQKPHSTGTIHEVTAQLMMSVRLSFWPVAVCSCVAQMASFILIKAPPQPQQSPQPVLSTLLFMYLPGPAR
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
NF2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • SDS-Page
  • Western Blot
Theoretical MW
34.76 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human NF2/Merlin GST (N-Term) Protein

  • ACN
  • BANF
  • Merlin
  • moesin-ezrin-radixin like
  • Moesin-ezrin-radixin-like protein
  • moesin-ezrin-radizin-like protein
  • neurofibromin 2 (bilateral acoustic neuroma)
  • neurofibromin 2 (merlin)
  • neurofibromin-2
  • NF2
  • SCH
  • Schwannomerlin
  • Schwannomin

Background

Neurofibromin 2 (NF2) is a tumor suppressor gene encoding the protein Merlin. Merlin is closely related to the ERM (ezrin, radixin, moesin) family of proteins. The precise funtion of Merlin is not clear. It is thought to provide a link between the actin cytoskeleten and membrane associated proteins, playing a role in transduction of extracellular signals. It has been implicated in cell proliferation and cellular motility. Mutations in the NF2 gene cause neurofibromatosis type II, a condition characterised by the development of tumors in the central nervous system.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

BBS9 Antibody
NBP1-88927
Immunohistochemistry-Paraffin BBS9 Antibody
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
LMOD1 Antibody
NBP1-89396
Immunocytochemistry/ Immunofluorescence LMOD1 Antibody
Immunohistochemistry-Paraffin LMOD1 Antibody
Immunohistochemistry-Paraffin LMOD1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DIO2 Antibody
NBP1-00178
Flow Cytometry DIO2 Antibody
Immunocytochemistry/ Immunofluorescence DIO2 Antibody
Immunohistochemistry-Frozen DIO2 Antibody
(7 Publications)
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
Dopamine D1R/DRD1
Antibody (SG2-D1a)
NB110-60017
Immunohistochemistry Dopamine D1R/DRD1 Antibody (SG2-D1a)
Western Blot Dopamine D1R/DRD1 Antibody (SG2-D1a)
Immunohistochemistry Free-Floating Dopamine D1R/DRD1 Antibody (SG2-D1a)
(3 Reviews)
(18 Publications)
Species: Bv(-), Ca(-), Hu(-), Mu, Po(-), Rb(-), Rt, Sh(-)
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, WB
Ezrin Antibody
NBP2-16396
Immunohistochemistry-Paraffin Ezrin Antibody
Immunohistochemistry-Paraffin Ezrin Antibody
Western Blot Ezrin Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-P, WB
Neurofibromin 1
Antibody
NB300-155
Immunohistochemistry Neurofibromin 1 Antibody
Western Blot Neurofibromin 1 Antibody
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Moesin Antibody
(MSN/491)
NBP2-32875
Flow Cytometry Moesin Antibody (MSN/491)
Immunocytochemistry/ Immunofluorescence Moesin Antibody (MSN/491)
Western Blot Moesin Antibody (MSN/491)
(1 Publication)
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Radixin Antibody
(1D9)
H00005962-M06
Western Blot Radixin Antibody (1D9)
Immunohistochemistry Radixin Antibody (1D9)
Immunocytochemistry/ Immunofluorescence Radixin Antibody (1D9)
(7 Publications)
Species: Ch, Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Dopamine D2R/DRD2
Antibody (HL1478) - A ...
NBP3-25443
Western Blot Dopamine D2R/DRD2 Antibody (HL1478) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence Dopamine D2R/DRD2 Antibody (HL1478) - Azide and BSA Free
Immunohistochemistry-Paraffin Dopamine D2R/DRD2 Antibody (HL1478) - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: Func, ICC/IF, IHC, IHC-P, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Neprilysin/CD10
Antibody [Unconjugate
AF1126
Immunohistochemistry Neprilysin/CD10 Antibody [Unconjugated]
Western Blot Neprilysin/CD10 Antibody [Unconjugated]
Western Blot Neprilysin/CD10 Antibody [Unconjugated]
(22 Publications)
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Adenosine A2aR
Antibody (7F6-G5-A2) ...
NBP1-39474
Western Blot Adenosine A2aR Antibody (7F6-G5-A2) - BSA Free
Immunocytochemistry/ Immunofluorescence Adenosine A2aR Antibody (7F6-G5-A2) - BSA Free
Immunocytochemistry/ Immunofluorescence Adenosine A2aR Antibody (7F6-G5-A2) - BSA Free
(16 Publications)
Species: Ca, Gp, Hu, Mu, Po, Rb, Rt, Sh
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
(1 Review)
(18 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow Cytometry p53 Antibody (PAb 240) - BSA Free
Flow (Intracellular) p53 Antibody (PAb 240) - BSA Free
(3 Reviews)
(39 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
ERMAP Antibody
AF4928
Flow Cytometry ERMAP Antibody
Species: Hu
Applications: CyTOF-ready, Flow, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Recombinant Human
NF2/Merlin GST (N-Ter ...
H00004771-P01
Recombinant Human NF2/Merlin GST (N-Term) Protein
Species: Hu
Applications: WB, ELISA, MA, PAGE, AP

Publications for NF2/Merlin Recombinant Protein (H00004771-P01) (0)

There are no publications for NF2/Merlin Recombinant Protein (H00004771-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NF2/Merlin Recombinant Protein (H00004771-P01) (0)

There are no reviews for NF2/Merlin Recombinant Protein (H00004771-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for NF2/Merlin Recombinant Protein (H00004771-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NF2/Merlin Products

Research Areas for NF2/Merlin Recombinant Protein (H00004771-P01)

Find related products by research area.

Blogs on NF2/Merlin

There are no specific blogs for NF2/Merlin, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
p19ARF/CDKN2A Antibody - BSA Free
NB200-106

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human NF2/Merlin GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol NF2