![Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining in human testis and kidney tissues . Corresponding NCAPH RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/NCAPH-Antibody-Immunohistochemistry-Paraffin-NBP1-88345-img0016.jpg "Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining in human testis and kidney tissues . Corresponding NCAPH RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, Simple Western, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KFTNTQITEHYSTCIKLSTENKITTKNAFGLHLIDFMSEILKQKDTEPTNFKVAAGTLDASTKIYAVRVDAVHADVYRVLGGLGKDAPSLEEVEGHVADGSATEMGTTKKAVKPKKKHLHRTIEQNINNLNVSEADRKCEI |
| Localization | Subcellular |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NCAPH |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. In In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue. |
||
| Theoretical MW | 82 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for NCAPH Antibody (NBP1-88345)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NCAPH |
![Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining of human kidney, skin, testis and tonsil using Anti-NCAPH antibody NBP1-88345 (A) shows similar protein distribution across tissues to independent antibody NBP1-88346 (B).](http://images.novusbio.com/fullsize/NCAPH-Antibody-Immunohistochemistry-Paraffin-NBP1-88345-img0020.jpg "Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining of human kidney, skin, testis and tonsil using Anti-NCAPH antibody NBP1-88345 (A) shows similar protein distribution across tissues to independent antibody NBP1-88346 (B).")
![Western Blot: NCAPH Antibody [NBP1-88345] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-NCAPH antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/NCAPH-Antibody-Western-Blot-NBP1-88345-img0019.jpg "Western Blot: NCAPH Antibody [NBP1-88345] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-NCAPH antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
![Western Blot: NCAPH Antibody [NBP1-88345] - Analysis in human cell lines U2OS and SK-MEL-30 using anti-NCAPH antibody. Corresponding NCAPH RNA-seq data are presented for the same cell lines. Loading control: anti-COX4I1.](http://images.novusbio.com/fullsize/NCAPH-Antibody-Western-Blot-NBP1-88345-img0018.jpg "Western Blot: NCAPH Antibody [NBP1-88345] - Analysis in human cell lines U2OS and SK-MEL-30 using anti-NCAPH antibody. Corresponding NCAPH RNA-seq data are presented for the same cell lines. Loading control: anti-COX4I1.")
![Immunocytochemistry/Immunofluorescence: NCAPH Antibody [NBP1-88345] - Staining of human cell line U-2 OS shows localization to nucleus and cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/NCAPH-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88345-img0017.jpg "Immunocytochemistry/Immunofluorescence: NCAPH Antibody [NBP1-88345] - Staining of human cell line U-2 OS shows localization to nucleus and cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining of human kidney shows no positivity as expected.](http://images.novusbio.com/fullsize/NCAPH-Antibody-Immunohistochemistry-Paraffin-NBP1-88345-img0012.jpg "Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining of human kidney shows no positivity as expected.")
![Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining of human skin shows nuclear positivity in epidermal cells.](http://images.novusbio.com/fullsize/NCAPH-Antibody-Immunohistochemistry-Paraffin-NBP1-88345-img0013.jpg "Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining of human skin shows nuclear positivity in epidermal cells.")
![Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining of human testis shows positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/NCAPH-Antibody-Immunohistochemistry-Paraffin-NBP1-88345-img0014.jpg "Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining of human testis shows positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining of human tonsil shows nuclear positivity in germinal center cells.](http://images.novusbio.com/fullsize/NCAPH-Antibody-Immunohistochemistry-Paraffin-NBP1-88345-img0015.jpg "Immunohistochemistry-Paraffin: NCAPH Antibody [NBP1-88345] - Staining of human tonsil shows nuclear positivity in germinal center cells.")
![Simple Western: NCAPH Antibody [NBP1-88345] - Simple Western lane view shows a specific band for NCAPH in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize/NCAPH-Antibody-Simple-Western-NBP1-88345-img0006.jpg "Simple Western: NCAPH Antibody [NBP1-88345] - Simple Western lane view shows a specific band for NCAPH in 0.2 mg/ml of RT-4 (Left) and U-251MG (Right) lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Simple Western: NCAPH Antibody [NBP1-88345] - Electropherogram image(s) of corresponding Simple Western lane view. NCAPH antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).](http://images.novusbio.com/fullsize/NCAPH-Antibody-Simple-Western-NBP1-88345-img0007.jpg "Simple Western: NCAPH Antibody [NBP1-88345] - Electropherogram image(s) of corresponding Simple Western lane view. NCAPH antibody was used at 1:20 dilution on RT-4 and U-251MG lysate(s).")
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")