Novus Biologicals products are now on bio-techne.com

MYO9B Recombinant Protein Antigen

Name: MYO9B Recombinant Protein Antigen
Brand: Novus Biologicals
SKU: NBP1-84548PEP
Price: 279 USD

Images

There are currently no images for MYO9B Protein (NBP1-84548PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary

Reactivity	HuSpecies Glossary
Applications	AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

MYO9B Recombinant Protein Antigen Summary

Description	A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MYO9B. Source: E. coli Amino Acid Sequence: TDGERSAKKPAVQKKKPGDASSLPDAGLSPGSQVDSKSTFKRLFLHKTKDKKYSLEGAEELENAVSGHVVLEATTM Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source	E. coli
Protein/Peptide Type	Recombinant Protein Antigen
Gene	MYO9B
Purity	>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions	Antibody Competition 10 - 100 molar excess
Application Notes	This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84548. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com For further blocking peptide related information and a protocol, click here.
Theoretical MW	26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage	Store at -20C. Avoid freeze-thaw cycles.
Buffer	PBS and 1M Urea, pH 7.4.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MYO9B Recombinant Protein Antigen

CELIAC4
myosin IXB
myosin-IXb
MYR5Unconventional myosin-9b
unconventional myosin IXb

Background

Myosin IX belongs to the family of unconventional myosins, distinct from the classical myosins I and myosins II. Myosin IX, thought to be involved in signal transduction and leukocyte differentiation, includes several isoforms. The rat isoforms are myosin IX/Myr5 (230 kDa) and Myr7 (300 kDa), and the human isoforms are myosin IXa (MYO9A) and myosin IXb (MYO9B). The isoforms of myosin IX have similar overall domain structure and are expressed in many tissues and cell types, although they have distinct tissue expression patterns. The subcellular localization of class IX myosins appears to be partly cytoplasmic, and partly associated with membranes and the actin cytoskeleton. The expression level of myosins IX may vary during development and differentiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CTLA-4
[Unconjugated]

7268-CT

(3 Publications)

Species: Hu

Applications: BA

Rhodopsin Antibody
(4D2)

NBP2-59690

Immunohistochemistry Rhodopsin Antibody (4D2)

(1 Review)

(6 Publications)

Species: Am, Av, Fi, Ma, Ze

Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB

RhoD Antibody

NBP1-58359

Species: Hu

Applications: IHC, IHC-P, WB

NOD2 Antibody
(2D9) - BSA Free

NB100-524

Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free

(1 Review)

(26 Publications)

Species: Hu, Mu

Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Claudin-1 Antibody
(1C5-D9)

H00009076-M01

Immunohistochemistry-Paraffin Claudin-1 Antibody (1C5-D9)

(2 Reviews)

(26 Publications)

Species: Hu, Pm, Mu

Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB

Myosin Heavy Chain
Antibody (MF20) [Unco ...

MAB4470

Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]

(1 Review)

(158 Publications)

Species: All-Multi

Applications: ICC, IHC, WB

Calmodulin 2
Antibody

NBP2-14871

(1 Publication)

Species: Mu, Rt

Applications: ICC/IF, WB

Calmodulin
Antibody (2D1) - BSA

NB120-2860

(3 Publications)

Species: Ba, Bv, Ch, Hu, Mu, Rt

Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB

Calmodulin 3
Antibody

NBP2-15669

Immunohistochemistry Whole-Mount Calmodulin 3 Antibody

(1 Publication)

Species: Mu, Rt, Ze

Applications: IHC-WhMt, IHC, WB

Myosin 1E Antibody

NBP1-92158

Species: Hu

Applications: IHC, IHC-P, WB

RhoA Antibody

NB100-91273

Immunohistochemistry-Paraffin RhoA Antibody

(1 Review)

(5 Publications)

Species: Hu, Mu, Pm, Rt

Applications: ICC/IF, IHC, IHC-P, WB

HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...

NBP2-79843

Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free

Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free

Species: Hu

Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB

IL-21 Antibody
[Unconjugated]

AF594

Neutralization IL-21 Antibody [Unconjugated]

(73 Publications)

Species: Mu

Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, Neut, WB

IL-2 [Unconjugated]

202-IL

(4 Reviews)

(370 Publications)

Species: Hu

Applications: BA

Tight Junction
Protein 1 Antibody

NBP1-85047

Immunohistochemistry-Paraffin Tight Junction Protein 1 Antibody

(5 Reviews)

(20 Publications)

Species: Hu, Mu, Po, Rt

Applications: ICC/IF, IHC, IHC-P, Simple Western, WB

IL-23R Antibody

NB600-1147

(1 Review)

(8 Publications)

Species: Hu, Mu

Applications: Flow-CS, Flow, IHC, IHC-P, Simple Western, WB

TNF-alpha
[Unconjugated]

210-TA

(3 Reviews)

(807 Publications)

Species: Hu

Applications: BA

Occludin Antibody

NBP1-87402

Immunohistochemistry-Paraffin Occludin Antibody

(4 Reviews)

(23 Publications)

Species: Hu, Mu, Rt

Applications: ELISA, IHC, IHC-P, KD, WB

Publications for MYO9B Protein (NBP1-84548PEP) (0)

There are no publications for MYO9B Protein (NBP1-84548PEP).

By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MYO9B Protein (NBP1-84548PEP) (0)

There are no reviews for MYO9B Protein (NBP1-84548PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.

Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MYO9B Protein (NBP1-84548PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MYO9B Products

Research Areas for MYO9B Protein (NBP1-84548PEP)

Find related products by research area.

Signal Transduction

Blogs on MYO9B

There are no specific blogs for MYO9B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.

TNF-alpha [Unconjugated]
210-TA-005

As an alternative, please consider our next generation Recombinant Human IL-2 (BT-002). It has equivalent bioactivity to Recombinant Human IL-2 (Catalog # 202-IL). It combines R&D Systems quality with scalability that allows for a solid supply chain. Both Recombinant Human IL-2 proteins are measured in a cell proliferation assay using CTLL 2 mouse cytotoxic T cells.

IL-2 [Unconjugated]
202-IL-010

Contact Information

Product PDFs

SDS

PDF Datasheet

Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

Volume

Mass

Concentration

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

Mass

Concentration

Volume

Molecular Weight* g/mol

Review this Product

Be the first to review our MYO9B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol

MYO9B

Popular Products	Company Information	Support	Stay Connected
Antibodies Secondary Antibodies Isotype Controls Proteins and Peptides ELISA Kits Sample Size New Products	About Us Careers Novus Guarantee Contact Us Our Team	Technical Support FAQs Help Finding Antibodies Protocols

Visit our other sites

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

MYO9B Recombinant Protein Antigen

Species Glossary

Images

Product Details

Order Details

MYO9B Recombinant Protein Antigen Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for MYO9B Recombinant Protein Antigen

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for MYO9B Protein (NBP1-84548PEP) (0)

Reviews for MYO9B Protein (NBP1-84548PEP) (0)

FAQs for MYO9B Protein (NBP1-84548PEP) (0)

Additional MYO9B Products

Research Areas for MYO9B Protein (NBP1-84548PEP)

Blogs on MYO9B

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Molarity Calculator

Review this Product

Bioinformatics