I would like to know, please, if you sell an Mrs2 (Magnesium Transporter) antibody to detect yeast Mrs2. i have seen you have a a couple of them for detection of human Mrs2. As the sequence identity between both species (yeast and human) is low, I am not sure if these antibodies would cross react.

Name: MRS2 Antibody
Brand: Novus Biologicals
SKU: NBP2-34200
Price: 519 USD

Question

Accepted Answer

Currently we have two antibodies to MRS2. Unfortunately, neither has been tested for cross reaction with the yeast protein. I was also not able to find the yeast sequence to run alignments against our products. If you have this and would like me to run an alignment against our two products, I would be happy to do so. We typically like to see 80+% homology between sequences for ideal cross reaction, but we have seen much lower percentages yield positive results. Since this species would not be covered under our 100% guarantee, we can offer you our Innovators Reward Program if you decide to try one of our products. In exchange for a review of your experiment using one of our products, we would issue you a credit for the purchase price of the antibody for use in a future purchase.

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	Hu, Mu, RtSpecies Glossary
Applications	WB, IHC
Clonality	Polyclonal
Host	Rabbit
Conjugate	Unconjugated

Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: NTLQGKLSILQPLILETLDALVDPKHSSVDRSKLHILLQNGKSLSELETDIKIFKESILEILDEEELLEELCVSKWSDPQVFEKSSAGIDHAEEMELLLENYYRLADDLSNAARELRVLIDDSQSIIFI
Predicted Species	Mouse (90%), Rat (93%). Backed by our 100% Guarantee.
Isotype	IgG
Clonality	Polyclonal
Host	Rabbit
Gene	MRS2
Purity	Immunogen affinity purified
Innovator's Reward	Test in a species/application not listed above to receive a full credit towards a future purchase. Learn about the Innovator's Reward

Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer	PBS (pH 7.2) and 40% Glycerol
Preservative	0.02% Sodium Azide
Purity	Immunogen affinity purified

Publications using NBP2-34200	Applications	Species
Joshi A, Gohil VM Cardiolipin deficiency leads to the destabilization of mitochondrial magnesium channel MRS2 in Barth syndrome Human molecular genetics 2023-09-18 [PMID: 37721533]
Shanmughapriya S, Ponnusamy T, Velusamy P et al. Mitochondrial Magnesium is the cationic rheostat for MCU-mediated mitochondrial Ca2+ uptake Research square 2023-07-18 [PMID: 37502932]
Liu M, Liu H, Feng F et al. TRPM7 kinase mediates hypomagnesemia-induced seizure-related death Scientific reports 2023-05-15 [PMID: 37188671] (WB, Mouse)	WB	Mouse
Tebbenkamp ATN, Varela L, Choi J et al. The 7q11.23 Protein DNAJC30 Interacts with ATP Synthase and Links Mitochondria to Brain Development. Cell. 2018-10-05 [PMID: 30318146] (WB, Human)	WB	Human

MRS2 Antibody

Species Glossary

Images

Product Details

Order Details

MRS2 Antibody Summary

Applications/Dilutions

Packaging, Storage & Formulations

Alternate Names for MRS2 Antibody

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for MRS2 Antibody (NBP2-34200)(4)

Reviews for MRS2 Antibody (NBP2-34200) (0)

Product General Protocols

Video Protocols

FAQs for MRS2 Antibody (NBP2-34200). (Showing 1 - 1 of 1 FAQs).

Secondary Antibodies

Isotype Controls

Additional MRS2 Products

Blogs on MRS2

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics

Gene Symbol	MRS2
Uniprot	Q9HD23(Human)