Home » MRCK » MRCK Proteins » MRCK Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

MRCK Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for MRCK Recombinant Protein Antigen (NBP2-55964PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

MRCK Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MRCK.

Source: E. coli

Amino Acid Sequence: TRRESQSEREEFESEFKQQYEREKVLLTEENKKLTSELDKLTTLYENLSIHNQQLEEEVKD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDC42BPA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55964.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MRCK Recombinant Protein Antigen

  • CDC42 binding protein kinase alpha (DMPK-like)
  • CDC42 binidng protein kinase beta
  • CDC42-binding protein kinase alpha (DMPK-like)
  • CDC42-binding protein kinase alpha
  • DMPK-like alpha
  • EC 2.7.11
  • EC 2.7.11.1
  • KIAA0451DKFZp686L1738
  • MRCK alpha
  • MRCK
  • MRCKADKFZp686P1738
  • Myotonic dystrophy kinase-related CDC42-binding kinase alpha
  • myotonic dystrophy kinase-related CDC42-binding protein kinase alpha
  • Myotonic dystrophy protein kinase-like alpha
  • PK428FLJ23347
  • serine/threonine-protein kinase MRCK alpha
  • ser-thr protein kinase PK428
  • ser-thr protein kinase related to the myotonic dystrophy protein kinase

Background

MRCK is encoded by this gene is a member of the Serine/Threonine protein kinase family. This kinase contains multiple functional domains. Its kinase domain is highly similar to that of the myotonic dystrophy protein kinase (DMPK). This kinase also contains a Rac interactive binding (CRIB) domain, and has been shown to bind CDC42. It may function as a CDC42 downstream effector mediating CDC42 induced peripheral actin formation, and promoting cytoskeletal reorganization. Multiple alternatively spliced transcript variants have been described, and the full-length nature of two of them has been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

DMPK Antibody
(713931)
MAB6967
Western Blot DMPK Antibody (713931)
Species: Hu
Applications: WB
CDC42 Antibody
(JJ086-04)
NBP2-67895
Flow Cytometry CDC42 Antibody (JJ086-04)
Immunohistochemistry-Paraffin CDC42 Antibody (JJ086-04)
Immunohistochemistry-Paraffin CDC42 Antibody (JJ086-04)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
Rhodopsin Antibody
(4D2)
NBP2-59690
Immunohistochemistry-Frozen Rhodopsin Antibody (4D2)
Western Blot Rhodopsin Antibody (4D2)
Immunohistochemistry Rhodopsin Antibody (4D2)
(1 Review)
(6 Publications)
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
RhoD Antibody
NBP1-58359
Immunohistochemistry-Paraffin RhoD Antibody
Western Blot RhoD Antibody
Immunohistochemistry RhoD Antibody
Species: Hu
Applications: IHC, IHC-P, WB
PKN1 Antibody
NB100-56159
PKN1 Antibody
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
MLC1 Antibody
NBP1-81555
Western Blot MLC1 Antibody
Immunohistochemistry-Paraffin MLC1 Antibody
Immunohistochemistry-Paraffin MLC1 Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
CDC42BPB Antibody
NBP1-81440
Immunohistochemistry-Paraffin CDC42BPB Antibody
Immunohistochemistry-Paraffin CDC42BPB Antibody
Immunohistochemistry-Paraffin CDC42BPB Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
PAK1 Antibody (4D1)
H00005058-M02
Western Blot PAK1 Antibody (4D1)
Western Blot PAK1 Antibody (4D1)
Immunocytochemistry/ Immunofluorescence PAK1 Antibody (4D1)
(1 Publication)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
Myosin Heavy Chain
Antibody (MF20) [Unco ...
MAB4470
Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]
Immunohistochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]
Immunocytochemistry Myosin Heavy Chain Antibody (MF20) [Unconjugated]
(1 Review)
(165 Publications)
Species: All-Multi
Applications: ICC, IHC, WB
MYO18A Antibody
NBP1-83020
Immunohistochemistry-Paraffin MYO18A Antibody
Immunohistochemistry-Paraffin MYO18A Antibody
Immunohistochemistry-Paraffin MYO18A Antibody
Species: Hu
Applications: IHC, IHC-P
Tenascin C
Antibody (4C8MS) - BS
NB110-68136
Flow Cytometry Tenascin C Antibody (4C8MS) - BSA Free
Immunocytochemistry/ Immunofluorescence Tenascin C Antibody (4C8MS) - BSA Free
Flow Cytometry Tenascin C Antibody (4C8MS) - BSA Free
(2 Reviews)
(26 Publications)
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
HSP10/EPF Antibody
[Unconjugated]
AF2584
Western Blot HSP10/EPF Antibody [Unconjugated]
Simple Western HSP10/EPF Antibody [Unconjugated]
Species: Mu
Applications: Simple Western, WB
Myoglobin Antibody
[Unconjugated]
G-125-C
Myoglobin Antibody [Unconjugated]
Species: Hu
Applications: Secondary
Myosin Light Chain
2 Antibody
NBP1-85541
Immunohistochemistry-Paraffin Myosin Light Chain 2 Antibody
Immunohistochemistry-Paraffin Myosin Light Chain 2 Antibody
Immunohistochemistry-Paraffin Myosin Light Chain 2 Antibody
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
CDC42BPG Antibody
NBP2-38938
Immunohistochemistry-Paraffin CDC42BPG Antibody
Immunohistochemistry-Paraffin CDC42BPG Antibody
Immunohistochemistry-Paraffin CDC42BPG Antibody
Species: Hu
Applications: IHC, IHC-P
MYLK3 Antibody
NBP2-62682
Immunohistochemistry-Paraffin MYLK3 Antibody
Immunohistochemistry-Paraffin MYLK3 Antibody
Immunohistochemistry-Paraffin MYLK3 Antibody
Species: Hu
Applications: IHC, IHC-P

Publications for MRCK Recombinant Protein Antigen (NBP2-55964PEP) (0)

There are no publications for MRCK Recombinant Protein Antigen (NBP2-55964PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRCK Recombinant Protein Antigen (NBP2-55964PEP) (0)

There are no reviews for MRCK Recombinant Protein Antigen (NBP2-55964PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MRCK Recombinant Protein Antigen (NBP2-55964PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MRCK Products

Array NBP2-55964PEP

Research Areas for MRCK Recombinant Protein Antigen (NBP2-55964PEP)

Find related products by research area.

Blogs on MRCK

There are no specific blogs for MRCK, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MRCK Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol CDC42BPA