![Western Blot: CDC42BPB Antibody [NBP1-81440] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).](http://images.novusbio.com/fullsize/CDC42BPB-Antibody-Western-Blot-NBP1-81440-img0006.jpg "Western Blot: CDC42BPB Antibody [NBP1-81440] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KSKFSGAVLNVPDTSDNSKKQMLRTRSKRRFVFKVPEEERLQQRREMLRDPELRSKMISNPTNFNHVAHMGPGDGMQVLMDLPLSAVPPSQEERPGPAPTNLARQPPSRNKPYISWPSSGGSEPSVTVPLRSMSDPDQDFDKEPDSDST |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CDC42BPB |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
| Publication using NBP1-81440 | Applications | Species |
|---|---|---|
| Baran B, Kosieradzka K, Skarzynska W, Niewiadomski P MRCK?/? positively regulates Gli protein activity Cellular signalling 2023-04-03 [PMID: 37019250] (WB, Human) Details: Dilution: 1:1000 |
WB | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for CDC42BPB Antibody (NBP1-81440)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CDC42BPB |
![Immunohistochemistry-Paraffin: CDC42BPB Antibody [NBP1-81440] - Staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/CDC42BPB-Antibody-Immunohistochemistry-Paraffin-NBP1-81440-img0011.jpg "Immunohistochemistry-Paraffin: CDC42BPB Antibody [NBP1-81440] - Staining of human placenta shows moderate to strong cytoplasmic positivity in trophoblastic cells.")
![Western Blot: CDC42BPB Antibody [NBP1-81440] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/CDC42BPB-Antibody-Western-Blot-NBP1-81440-img0005.jpg "Western Blot: CDC42BPB Antibody [NBP1-81440] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
![Immunohistochemistry-Paraffin: CDC42BPB Antibody [NBP1-81440] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.](http://images.novusbio.com/fullsize/CDC42BPB-Antibody-Immunohistochemistry-Paraffin-NBP1-81440-img0009.jpg "Immunohistochemistry-Paraffin: CDC42BPB Antibody [NBP1-81440] - Staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.")
![Immunohistochemistry-Paraffin: CDC42BPB Antibody [NBP1-81440] - Staining of human skeletal muscle shows moderate to strong cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/CDC42BPB-Antibody-Immunohistochemistry-Paraffin-NBP1-81440-img0010.jpg "Immunohistochemistry-Paraffin: CDC42BPB Antibody [NBP1-81440] - Staining of human skeletal muscle shows moderate to strong cytoplasmic positivity in myocytes.")
![Immunohistochemistry-Paraffin: CDC42BPB Antibody [NBP1-81440] - Staining of human testis shows moderate to strong cytoplasmic positivity in Leydig cells.](http://images.novusbio.com/fullsize/CDC42BPB-Antibody-Immunohistochemistry-Paraffin-NBP1-81440-img0012.jpg "Immunohistochemistry-Paraffin: CDC42BPB Antibody [NBP1-81440] - Staining of human testis shows moderate to strong cytoplasmic positivity in Leydig cells.")
![SDS-PAGE IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images2/IL-1_beta_201-LB_304.jpg)
![Bioactivity IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images2/IL-1_beta_201-LB_306.jpg)
![SEC-MALS IL-1 beta/IL-1F2 [Unconjugated]](https://images.novusbio.com/images/201-lb_recombinant-human-il-1-beta-il-1f2-protein-sec-mals-123202491556.jpg)
![Bioactivity BMP-7 [Unconjugated]](https://images.novusbio.com/images/protein/354-bp_recombinant-human-bmp-7-protein-bioactivity-7122020141940.jpg)
![Cell Culture BMP-7 [Unconjugated]](https://images.novusbio.com/images/354-bp_recombinant-human-bmp-7-protein-cell-culture-252023113257..jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Immunohistochemistry Cathepsin B Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_B_AF965_Immunohistochemistry_6922.jpg)
![Immunocytochemistry/ Immunofluorescence Cathepsin B Antibody [Unconjugated]](https://images.novusbio.com/images/af965_mouse-cathepsin-b-affinity-purified-polyclonal-ab-822024950321.jpg)
![Immunocytochemistry/ Immunofluorescence Cathepsin B Antibody [Unconjugated]](https://images.novusbio.com/images/af965_mouse-cathepsin-b-affinity-purified-polyclonal-ab-822024950468.jpg)
![Western Blot Cathepsin L Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_L_AF952_Western_Blot_20998.jpg)
![Immunohistochemistry Cathepsin L Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_L_AF952_Immunohistochemistry_17794.jpg)
![Western Blot Cathepsin L Antibody [Unconjugated]](https://images.novusbio.com/images/af952_human-cathepsin-l-affinity-purified-polyclonal-ab-8220249511428.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")