MPRA Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to the amino acids: MAMAQKLSHLLPSLRQVIQEPQLSLQPEPVFTVDRAEVPPLFWKPYIYAGYRPLHQTWRFYFRTLFQQHNEA |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
PAQR7 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Rat (81%)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for MPRA Antibody
Background
The steroid progesterone induces the resumption of maturation in oocytes via a nongenomic pathway through binding to a novel, membrane progestin receptor (mPR). This pathway inhibits adenylyl cyclase and reduces intracellular cAMP, and also activates mitogen-activated protein kinase to effect signal transduction pathways. Three distinct groups, designated alpha, beta and gamma, comprise this gene family. mPRalpha, also designated progestin and adipoQ receptor family member VII (PAQR7), consists of an extracellular N-terminus, an intracellular C-terminus, and seven transmembrane domains. It is expressed in ovary, testis, placenta, uterus and bladder. mPRbeta, also designated progestin and adipoQ receptor family member VIII (PAQR8), consists of eight putative transmembrane regions and an intracellular N-terminus that contains a leucine-rich motif. It is a 354 amino acid protein with a molecular mass of about 40 kDa and is expressed in brain and spinal cord. Both mPRalpha and mPRbeta may be G protein-coupled receptors and may be involved in oocyte maturation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PLA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Species: ChHa, SyHa, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt
Applications: B/N, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, PLA, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Dual ISH-IHC, ELISA, Flow, ICC/IF, IHC, IP, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu
Applications: ICC/IF
Publications for MPRA Antibody (NBP2-13731) (0)
There are no publications for MPRA Antibody (NBP2-13731).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MPRA Antibody (NBP2-13731) (0)
There are no reviews for MPRA Antibody (NBP2-13731).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MPRA Antibody (NBP2-13731) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MPRA Products
Blogs on MPRA