MOS Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: CKISDFGCSEKLEDLLCFQTPSYPLGGTYTHRAPELLKGEGVTPKADIYSFAITLWQMTTKQAPYSGERQHILYAVVAYDLRPSLSAAVF |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
MOS |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for MOS Antibody
Background
MOS is a 39kDa proto oncogene (c-Mos) encoded protein serine/threonine kinase. MOS is a monomeric protein that indirectly activates MAP kinase (Erk1/2) by directly phosphorylating MAP kinase kinase (Mck, MAPKK, MKK). MOS is known as a cytostatic factor (CSF) and is also thought to arrest unfertilized amphibian and mammalian cells during M phase, thus regulating oocyte maturation. MOS is destroyed before fertilisation, after exit from meiosis II, making it a good marker for studies of eggs during oogenesis and maturation.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Mu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: WB, IHC
Publications for MOS Antibody (NBP1-86241) (0)
There are no publications for MOS Antibody (NBP1-86241).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MOS Antibody (NBP1-86241) (0)
There are no reviews for MOS Antibody (NBP1-86241).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MOS Antibody (NBP1-86241) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MOS Products
Research Areas for MOS Antibody (NBP1-86241)
Find related products by research area.
|
Blogs on MOS